BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeroxisomal carnitine O-octanoyltransferase
LigandBDBM50284163
Substrate/Competitorn/a
Meas. Tech.ChEMBL_46183
IC50 912000±n/a nM
Citation Kumaravel, GBháird, NNFronczek, FRRamsay, RRAshendel, CLGandour, RD Evaluation of (2S,4S)/(2R,4R) and (2S,4R)/(2<... Bioorg Med Chem Lett4:883-886 (1994)    Article
More Info.:Get all data from this article,  Assay Method
 
Peroxisomal carnitine O-octanoyltransferase
Name:Peroxisomal carnitine O-octanoyltransferase
Synonyms:COT
Type:PROTEIN
Mol. Mass.:70184.70
Organism:Homo sapiens
Description:ChEMBL_46182
Residue:612
Sequence:
MENQLAKSTEERTFQYQDSLPSLPVPSLEESLKKYLESVKPFANQEEYKKTEEIVQKFQS
GIGEKLHQKLLERAKGKRNWLEEWWLNVAYLDVRIPSQLNVNFAGPAAHFEHYWPPKEGT
QLERGSITLWHNLNYWQLLRKEKVPVHKVGNTPLDMNQFRMLFSTCKVPGITRDSIMNYF
RTESEGRSPNHIVVLCRGRAFVFDVIHEGCLVTPPELLRQLTYIHKKCHSEPDGPGIAAL
TSEERTRWAKAREYLIGLDPENLALLEKIQSSLLVYSMEDSSPHVTPEDYSEIIAAILIG
DPTVRWGDKSYNLISFSNGVFGCNCDHAPFDAMIMVNISYYVDEKIFQNEGRWKGSEKVR
DIPLPEELIFIVDEKVLNDINQAKAQYLREASDLQIAAYAFTSFGKKLTKNKMLHPDTFI
QLALQLAYYRLHGHPGCCYETAMTRHFYHGRTETMRSCTVEAVRWCQSMQDPSVNLRERQ
QKMLQAFAKHNKMMKDCSAGKGFDRHLLGLLLIAKEEGLPVPELFTDPLFSKSGGGGNFV
LSTSLVGYLRVQGVVVPMVHNGYGFFYHIRDDRFVVACSAWKSCPETDAEKLVQLTFCAF
HDMIQLMNSTHL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50284163
NameBDBM50284163
Synonyms:(S)-4-Hexadecyl-2,6,6-trimethyl-2-oxo-2lambda*5*-[1,3,6,2]dioxazaphosphocan-6-ium; bromide | CHEMBL170076
TypeSmall organic molecule
Emp. Form.C23H49NO3P
Mol. Mass.418.6133
SMILESCCCCCCCCCCCCCCCCC1C[N+](C)(C)CCO[P@](C)(=O)O1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a