BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCysteinyl leukotriene receptor 1
LigandBDBM50009073
Substrate/Competitorn/a
Meas. Tech.ChEBML_99988
Ki 2.3±n/a nM
Citation Marfat, AChambers, RCheng, JCooper, KDamon, DDelehunt, JEggler, JMasamune, HMelvin, LWatson, J The discovery of CP-96,021 and CP-96,486, balanced, combined, potent and orally active leukotriene D4 (LTD4)/platelet activating factor (PAF) receptor antagonists. Bioorg Med Chem Lett5:1377-1382 (1995)    Article
More Info.:Get all data from this article,  Assay Method
 
Cysteinyl leukotriene receptor 1
Name:Cysteinyl leukotriene receptor 1
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:39007.58
Organism:GUINEA PIG
Description:Leukotriene D4 0 GUINEA PIG::Q2NNR5
Residue:340
Sequence:
MDETGNPTIPPASNNTCYDSIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLVKTYHEKSA
FQVYMINLAVADLLCVCTLPLRVAYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAM
SFFRCVAIVFPVQNISLVTQKKARLVCIAIWMFVILTSSPFLMANTYKDEKNNTKCFEPP
QDNQAKNYVLILHYVSLFIGFIIPFITIIVCYTMIIFTLLKSSMKKNLSSRKRAIGMIIV
VTAAFLVSFMPYHIQRTIHLHFLHNKTKPCDSILRMQKSVVITLSLAASNCCFDPLLYFF
SGGNFRRRLSTIRKYSLSSMTYIPKKKTSLPQKGKDICKE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50009073
NameBDBM50009073
Synonyms:4-(5-cyclopentyloxycarbonylamino-1-methyl-1H-indol-3-ylmethyl)-3-methoxy-N-o-tolylsulfonylbenzamide | CHEMBL603 | ZAFIRLUKAST | cyclopentyl 3-(2-methoxy-4-((o-tolylsulfonyl)carbamoyl)benzyl)-1-methylindole-5-carbamate | cyclopentyl 3-[2-methoxy-4-(2-methylphenylsulfonylcarbamoyl)benzyl]-1-methyl-1H-indol-5-ylcarbamate
TypeSmall organic molecule
Emp. Form.C31H33N3O6S
Mol. Mass.575.675
SMILESCOc1cc(ccc1Cc1cn(C)c2ccc(NC(=O)OC3CCCC3)cc12)C(=O)NS(=O)(=O)c1ccccc1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a