BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCaspase-1
LigandBDBM50284735
Substrate/Competitorn/a
Meas. Tech.ChEMBL_90990
KON 5600 M-1s-1
Citation Mjalli, AMZhao, JJChapman, KTThornberry, NAPeterson, EPMacCoss, MHagmann, WK Inhibition of interleukin-1β converting enzyme by N-acyl-aspartyl aryloxymethyl ketones Bioorg Med Chem Lett5:1409-1414 (1995)    Article
More Info.:Get all data from this article,  Assay Method
 
Caspase-1
Name:Caspase-1
Synonyms:Caspase 1 | ICE | Interleukin-1 beta convertase | Interleukin-1 beta-converting enzyme
Type:Enzyme
Mol. Mass.:45154.13
Organism:Homo sapiens (human)
Description:P29466
Residue:404
Sequence:
MADKVLKEKRKLFIRSMGEGTINGLLDELLQTRVLNKEEMEKVKRENATVMDKTRALIDS
VIPKGAQACQICITYICEEDSYLAGTLGLSADQTSGNYLNMQDSQGVLSSFPAPQAVQDN
PAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRT
GAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIR
EGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVG
VSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEY
ACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50284735
NameBDBM50284735
Synonyms:3-Allyloxycarbonylamino-5-(3-carbamoyl-naphthalen-2-yloxy)-4-oxo-pentanoic acid | CHEMBL31138
TypeSmall organic molecule
Emp. Form.C20H20N2O7
Mol. Mass.400.382
SMILESNC(=O)c1cc2ccccc2cc1OCC(=O)C(CC(O)=O)NC(=O)OCC=C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a