BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMatrix metalloproteinase-7 (MMP7)
LigandBDBM50284757
Substrate/Competitorn/a
Meas. Tech.ChEMBL_105051
Ki>620±n/a nM
Citation Castelhano, ALBilledeau, RDewdney, NDonnelly, SHorne, SKurz, LJLiak, TJMartin, RUppington, RYuan, ZKrantz, A Novel indolactam-based inhibitors of matrix metalloproteinases Bioorg Med Chem Lett5:1415-1420 (1995)    Article
More Info.:Get all data from this article,  Assay Method
 
Matrix metalloproteinase-7 (MMP7)
Name:Matrix metalloproteinase 7
Synonyms:Matrix metalloproteinase 7 | Matrix metalloproteinase-7 (MMP-7)
Type:Enzyme
Mol. Mass.:29681.54
Organism:Homo sapiens (Human)
Description:P09237
Residue:267
Sequence:
MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLK
EMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDL
PHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAF
APGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGD
PQNFKLSQDDIKGIQKLYGKRSNSRKK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50284757
NameBDBM50284757
Synonyms:(R)-3-[(S)-1-Hexylcarbamoyl-2-(1H-indol-3-yl)-ethylcarbamoyl]-5-methyl-hexanoic acid | CHEMBL286904
TypeSmall organic molecule
Emp. Form.C25H37N3O4
Mol. Mass.443.579
SMILESCCCCCCNC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CC(C)C)CC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a