BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-lactamase 1
LigandBDBM50285121
Substrate/Competitorn/a
Meas. Tech.ChEMBL_40230
IC50 1500000±n/a nM
Citation Danelon, GOMata, EGMascaretti, OAGirardini, JMarro, MRoveri, OA Synthesis and β-lactamase inhibitory evaluation of novel 6α-halo-2β-chloromethyl-2α-methylpenam-3α-carboxylic acids and their sulfones and 6α-halo-2β-mercaptobenzothiazolylmethyl-2α-methylpenam-3α-carboxylic acids Bioorg Med Chem Lett5:2037-2040 (1995)    Article
More Info.:Get all data from this article,  Assay Method
 
Beta-lactamase 1
Name:Beta-lactamase 1
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:33326.66
Organism:Bacillus cereus
Description:ChEMBL_40230
Residue:306
Sequence:
MILKNKRMLKIGICVGILGLSITSLEAFTGESLQVEAKEKTGQVKHKNQATHKEFSQLEK
KFDARLGVYAIDTGTNQTISYRPNERFAFASTYKALAAGVLLQQNSIDSLNEVITYTKED
LVDYSPVTEKHVDTGMKLGEIAEAAVRSSDNTAGNILFNKIGGPKGYEKALRHMGDRITM
SNRFETELNEAIPGDIRDTSTAKAIATNLKAFTVGNALPAEKRKILTEWMKGNATGDKLI
RAGIPTDWVVGDKSGAGSYGTRNDIAVVWPPNSAPIIVLISSKDEKEAIYNDQLIAEATK
VIVKGS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50285121
NameBDBM50285121
Synonyms:(2S,5R,6S)-6-Chloro-3,3-dimethyl-4,4,7-trioxo-4lambda*6*-thia-1-aza-bicyclo[3.2.0]heptane-2-carboxylic acid | CHEMBL304855
TypeSmall organic molecule
Emp. Form.C8H10ClNO5S
Mol. Mass.267.687
SMILESCC1(C)[C@@H](N2[C@@H]([C@@H](Cl)C2=O)S1(=O)=O)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a