BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-glucosidase A (α-Gal A)
LigandBDBM50288853
Substrate/Competitorn/a
Meas. Tech.ChEBML_216815
IC50>1000000±n/a nM
Citation Igarashi, YIchikawa, MIchikawa, Y Synthesis of a new inhibitor of α-fucosidase Bioorg Med Chem Lett6:553-558 (1996)    Article
More Info.:Get all data from this article,  Assay Method
 
Alpha-glucosidase A (α-Gal A)
Name:Alpha-galactosidase A
Synonyms:Alpha-D-galactosidase A | Alpha-D-galactoside galactohydrolase | INN=Agalsidase | Melibiase
Type:Protein
Mol. Mass.:48760.21
Organism:Homo sapiens (Human)
Description:n/a
Residue:429
Sequence:
MQLRNPELHLGCALALRFLALVSWDIPGARALDNGLARTPTMGWLHWERFMCNLDCQEEP
DSCISEKLFMEMAELMVSEGWKDAGYEYLCIDDCWMAPQRDSEGRLQADPQRFPHGIRQL
ANYVHSKGLKLGIYADVGNKTCAGFPGSFGYYDIDAQTFADWGVDLLKFDGCYCDSLENL
ADGYKHMSLALNRTGRSIVYSCEWPLYMWPFQKPNYTEIRQYCNHWRNFADIDDSWKSIK
SILDWTSFNQERIVDVAGPGGWNDPDMLVIGNFGLSWNQQVTQMALWAIMAAPLFMSNDL
RHISPQAKALLQDKDVIAINQDPLGKQGYQLRQGDNFEVWERPLSGLAWAVAMINRQEIG
GPRSYTIAVASLGKGVACNPACFITQLLPVKRKLGFYEWTSRLRSHINPTGTVLLQLENT
MQMSLKDLL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50288853
NameBDBM50288853
Synonyms:1-Butyl-5-methyl-piperidine-3,4-diol | CHEMBL356023
TypeSmall organic molecule
Emp. Form.C10H21NO2
Mol. Mass.187.2792
SMILESCCCCN1CC(C)C(O)C(O)C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a