BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-mannosidase
LigandBDBM50104412
Substrate/Competitorn/a
Meas. Tech.ChEBML_216949
IC50>1000000±n/a nM
Citation Igarashi, YIchikawa, MIchikawa, Y Synthesis of a new inhibitor of α-fucosidase Bioorg Med Chem Lett6:553-558 (1996)    Article
More Info.:Get all data from this article,  Assay Method
 
Alpha-mannosidase
Name:Alpha-mannosidase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:65344.50
Organism:Glycine max
Description:ChEMBL_32380
Residue:578
Sequence:
MARGSRSVGSSSSKWRYCNPSYYLKRPKRLALLFIVFVCVSFVFWDRQTLVREHQVEISE
LQKEVTDLKNLVDDLNNKQGGTSGKTDLGRKATKSSKDVLDDPIDIERREKVKEAMLHAW
GSYEKYAWGQDELQPQSKNGVNSFGGLGATLIDSLDTLYIMGLNEQFQKAREWVANSLDF
NKDYEASVFETTIRVVGGLLSAYDLSGDKVFLDKAIEIADRLLPAWNTPTGIPYNIINLS
HGRAHNPSWTGGESILADSGTEQLEFIVLSQRTGDLKYQQKVENVIAQLNKTFPDDGLLP
IYINPHSGAAGYSPITFGAMGDSFYEYLLKVWIQGNKTSSIKHYRDMWEKSMKGLSSLIR
RSTPSSFTYICEKNGGSLTDKMDELACFAPGMIALGSFGYSAADDSQKFLSLAEELAWTC
YNFYQSTPTKLAGENYFFHSGQDMSVGTSWNILRPETVESLFYLWRLTGNKTYQEWGWNI
FQAFEKNSRIESGYVGLKDVNSGVKDNMMQSFFLAETLKYFYLLFSPSSVISLDEWVFNT
EAHPLRIVTRHEEGLVKNLNEKQKPFSRIGGRKEGRSG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50104412
NameBDBM50104412
Synonyms:(S)-5-Methyl-piperidine-3,4-diol | CHEMBL86305
TypeSmall organic molecule
Emp. Form.C6H13NO2
Mol. Mass.131.1729
SMILESCC1CNC[C@H](O)C1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a