Target
Retinoic acid receptor gamma
Ligand
BDBM31883
Substrate
n/a
Meas. Tech.
ChEBML_196016
Ki
0.600000±n/a nM
Citation
 Wong, MFRepa, JJClagett-Dame, MCurley, RW Synthesis and receptor binding affinity of conformationally restricted retinoic acid analogues Bioorg Med Chem Lett 7:2313-2318 (1997)    Article
Target
Name:
Retinoic acid receptor gamma
Synonyms:
Nuclear receptor subfamily 1 group B member 3 | RAR-gamma | Retinoic acid receptor RXR-alpha/gamma | Retinoic acid receptor gamma | Retinoid receptor
Type:
PROTEIN
Mol. Mass.:
50345.43
Organism:
Homo sapiens (Human)
Description:
ChEMBL_1458016
Residue:
454
Sequence:
MATNKERLFAAGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMASLSVETQSTSSEEMVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSYELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEALRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPEMFEDDSSQPGPHPNASSEDEVPGGQGKGGLKSPA
  
Inhibitor
Name:
BDBM31883
Synonyms:
9-cis-retinoic acid (9cRA) | ALL-TRANS-RETINOIC ACID | AT-RA | Atralin | CHEMBL38 | MLS000028588 | SMR000058245 | TRETINOIN | Vitamin A acid | [3H]RA | [3H]Retinoic acid | [3H]Vitamin A acid | [3H]tretinoin | all-trans retinoic acid | cid_444795
Type:
radiolabeled ligand
Emp. Form.:
C20H28O2
Mol. Mass.:
300.4351
SMILES:
C\C(\C=C\C1=C(C)CCCC1(C)C)=C/C=C/C(/C)=C/C(O)=O |c:4|
Structure:
Search PDB for entries with ligand similarity: