Target
Retinoic acid receptor gamma
Ligand
BDBM50032219
Substrate
n/a
Meas. Tech.
ChEMBL_196308
EC50
2±n/a nM
Citation
 Beard, RLTeng, MColon, DFDuong, TTThacher, SMArefieg, TChandraratna, RA Synthesis and biological activity of 1,2,3,4-tetrahydroquinoline and 3,4-(1H)-dihydroquinolin-2-one analogs of retinoic acid Bioorg Med Chem Lett 7:2373-2378 (1997)    Article
Target
Name:
Retinoic acid receptor gamma
Synonyms:
Nuclear receptor subfamily 1 group B member 3 | RAR-gamma | Retinoic acid receptor RXR-alpha/gamma | Retinoic acid receptor gamma | Retinoid receptor
Type:
PROTEIN
Mol. Mass.:
50345.43
Organism:
Homo sapiens (Human)
Description:
ChEMBL_1458016
Residue:
454
Sequence:
MATNKERLFAAGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMASLSVETQSTSSEEMVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSYELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEALRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPEMFEDDSSQPGPHPNASSEDEVPGGQGKGGLKSPA
  
Inhibitor
Name:
BDBM50032219
Synonyms:
(E)-4-(2-(5,5,8,8-tetramethyl-5,6,7,8-tetrahydronaphthalen-2-yl)prop-1-enyl)benzoic acid | 4-(2-(5,5,8,8-tetramethyl-5,6,7,8-tetrahydronaphthalen-2-yl)prop-1-enyl)benzoic acid | 4-[(1E)-2-(5,5,8,8-TETRAMETHYL-5,6,7,8-TETRAHYDRONAPHTHALEN-2-YL)PROP-1-ENYL]BENZOIC ACID | 4-[(E)-2-(5,5,8,8-Tetramethyl-5,6,7,8-tetrahydro-naphthalen-2-yl)-propenyl]-benzoic acid | 4-[(E)-2-(5,6,7,8-tetrahydro-5,5,8,8-tetramethyl-2-naphthalenyl)-1-propenyl]benzoic acid | 4-[2-(5,5,8,8-Tetramethyl-5,6,7,8-tetrahydro-naphthalen-2-yl)-propenyl]-benzoic acid | CHEMBL275311 | US9963439, TTNPB
Type:
Small organic molecule
Emp. Form.:
C24H28O2
Mol. Mass.:
348.4779
SMILES:
C\C(=C/c1ccc(cc1)C(O)=O)c1ccc2c(c1)C(C)(C)CCC2(C)C
Structure:
Search PDB for entries with ligand similarity: