BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRetinoic acid receptor RXR-alpha/Retinoic acid receptor beta
LigandBDBM50290184
Substrate/Competitorn/a
Meas. Tech.ChEMBL_195797
EC50 3±n/a nM
Citation Beard, RLTeng, MColon, DFDuong, TTThacher, SMArefieg, TChandraratna, RA Synthesis and biological activity of 1,2,3,4-tetrahydroquinoline and 3,4-(1H)-dihydroquinolin-2-one analogs of retinoic acid Bioorg Med Chem Lett7:2373-2378 (1997)    Article
More Info.:Get all data from this article,  Assay Method
 
Retinoic acid receptor RXR-alpha/Retinoic acid receptor beta
Name:Retinoic acid receptor RXR-alpha/Retinoic acid receptor beta
Synonyms:HBV-activated protein | Nuclear receptor subfamily 1 group B member 2 | RAR-beta | RAR-epsilon | Retinoic acid receptor beta
Type:PROTEIN
Mol. Mass.:50498.70
Organism:Homo sapiens (Human)
Description:ChEMBL_1458015
Residue:455
Sequence:
MTTSGHACPVPAVNGHMTHYPATPYPLLFPPVIGGLSLPPLHGLHGHPPPSGCSTPSPAT
IETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNM
IYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKETSKQECTESYEM
TAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIV
EFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNA
GFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALK
IYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGH
EPLTPSSSGNTAEHSPSISPSSVENSGVSQSPLVQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50290184
NameBDBM50290184
Synonyms:4-(1-Isopropyl-4,4-dimethyl-1,2,3,4-tetrahydro-quinolin-7-ylethynyl)-benzoic acid | CHEMBL80271
TypeSmall organic molecule
Emp. Form.C23H25NO2
Mol. Mass.347.4501
SMILESCC(C)N1CCC(C)(C)c2ccc(cc12)C#Cc1ccc(cc1)C(O)=O
Structure
n/a