Target
Retinoic acid receptor beta
Ligand
BDBM50290188
Substrate
n/a
Meas. Tech.
ChEBML_195495
Ki
>1000±n/a nM
Citation
 Farmer, LJJeong, SKallel, EAKoch, SSCroston, GEFlatten, KSHeyman, RANadzan, AM Synthesis and structure-activity relationships of potent retinoid X receptor ligands Bioorg Med Chem Lett 7:2393-2398 (1997)    Article
Target
Name:
Retinoic acid receptor beta
Synonyms:
HBV-activated protein | Nuclear receptor subfamily 1 group B member 2 | RAR-beta | RAR-epsilon | Retinoic acid receptor RXR-alpha/Retinoic acid receptor beta | Retinoic acid receptor beta | Retinoid receptor
Type:
PROTEIN
Mol. Mass.:
50498.70
Organism:
Homo sapiens (Human)
Description:
ChEMBL_1458015
Residue:
455
Sequence:
MTTSGHACPVPAVNGHMTHYPATPYPLLFPPVIGGLSLPPLHGLHGHPPPSGCSTPSPATIETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMIYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKETSKQECTESYEMTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNTAEHSPSISPSSVENSGVSQSPLVQ
  
Inhibitor
Name:
BDBM50290188
Synonyms:
(2E,4E)-3-Methyl-5-[(1S,2R)-1-methyl-2-(5,5,8,8-tetramethyl-5,6,7,8-tetrahydro-naphthalen-2-yl)-cyclopentyl]-penta-2,4-dienoic acid | CHEMBL75814
Type:
Small organic molecule
Emp. Form.:
C26H36O2
Mol. Mass.:
380.5628
SMILES:
C\C(\C=C\[C@]1(C)CCC[C@@H]1c1ccc2c(c1)C(C)(C)CCC2(C)C)=C/C(O)=O
Structure:
Search PDB for entries with ligand similarity: