Target
Retinoic acid receptor alpha
Ligand
BDBM50290192
Substrate
n/a
Meas. Tech.
ChEBML_197412
Ki
>1000±n/a nM
Citation
 Farmer, LJJeong, SKallel, EAKoch, SSCroston, GEFlatten, KSHeyman, RANadzan, AM Synthesis and structure-activity relationships of potent retinoid X receptor ligands Bioorg Med Chem Lett 7:2393-2398 (1997)    Article
Target
Name:
Retinoic acid receptor alpha
Synonyms:
Nuclear receptor subfamily 1 group B member 1 | RAR-alpha | Retinoic acid receptor alpha | Retinoic acid receptor alpha/Retinoid X receptor alpha | Retinoid X receptor gamma/retinoic acid receptor alpha | Retinoid receptor
Type:
PROTEIN
Mol. Mass.:
50778.87
Organism:
Homo sapiens (Human)
Description:
ChEMBL_1466191
Residue:
462
Sequence:
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPATIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP
  
Inhibitor
Name:
BDBM50290192
Synonyms:
3-Methyl-5-[5-(5,5,8,8-tetramethyl-5,6,7,8-tetrahydro-naphthalen-2-yl)-bicyclo[3.1.0]hex-1-yl]-penta-2,4-dienoic acid | CHEMBL310047
Type:
Small organic molecule
Emp. Form.:
C26H34O2
Mol. Mass.:
378.547
SMILES:
C\C(\C=C\[C@]12CC1(CCC2)c1ccc2c(c1)C(C)(C)CCC2(C)C)=C/C(O)=O
Structure:
Search PDB for entries with ligand similarity: