BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetalpha-1 Nicotinic AChR
LigandBDBM50290629
Substrate/Competitorn/a
Meas. Tech.ChEMBL_223071
EC50>1000000±n/a nM
Citation Elliott, RLRyther, KBAnderson, DJPiattoni-Kaplan, MKuntzweiler, TADonnelly-Roberts, DArneric, SPHolladay, MW Novel 2-(2′-furo[3,2-b]pyridinyl) pyrrolidines: potent neuronal nicotinic acetylcholine receptor ligands Bioorg Med Chem Lett7:2703-2708 (1997)    Article
More Info.:Get all data from this article,  Assay Method
 
alpha-1 Nicotinic AChR
Name:alpha-1 Nicotinic AChR
Synonyms:Acetylcholine receptor protein alpha chain | Acetylcholine receptor subunit alpha | Cholinergic, Nicotinic Alpha1Beta1DeltaGamma | Cholinergic, Nicotinic Alpha1Beta2 | Nicotinic acetylcholine receptor alpha2/beta4 | n-AChR
Type:Ion channel
Mol. Mass.:54542.01
Organism:Homo sapiens (Human)
Description:n/a
Residue:482
Sequence:
MEPWPLLLLFSLCSAGLVLGSEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQL
INVDEVNQIVTTNVRLKQGDMVDLPRPSCVTLGVPLFSHLQNEQWVDYNLKWNPDDYGGV
KKIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHF
PFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPD
TPYLDITYHFVMQRLPLYFIVNVIIPCLLFSFLTGLVFYLPTDSGEKMTLSISVLLSLTV
FLLVIVELIPSTSSAVPLIGKYMLFTMVFVIASIIITVIVINTHHRSPSTHVMPNWVRKV
FIDTIPNIMFFSTMKRPSREKQDKKIFTEDIDISDISGKPGPPPMGFHSPLIKHPEVKSA
IEGIKYIAETMKSDQESNNAAAEWKYVAMVMDHILLGVFMLVCIIGTLAVFAGRLIELNQ
QG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50290629
NameBDBM50290629
Synonyms:(S)-2-Pyrrolidin-2-yl-furo[3,2-b]pyridine | CHEMBL91005
TypeSmall organic molecule
Emp. Form.C11H12N2O
Mol. Mass.188.2258
SMILESC1CN[C@@H](C1)c1cc2ncccc2o1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a