BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPlasminogen
LigandBDBM50291006
Substrate/Competitorn/a
Meas. Tech.ChEMBL_155392
IC50 15±n/a nM
Citation Tamura, SYGoldman, EABrunck, TKRipka, WCSemple, JE Rational design, synthesis, and serine protease inhibitory activity of a novel P1-argininal derivative featuring a conformationally constrained P2–P3 bicyclic lactam moiety Bioorg Med Chem Lett7:331-336 (1997)    Article
More Info.:Get all data from this article,  Assay Method
 
Plasminogen
Name:Plasminogen
Synonyms:Activation peptide | Angiostatin | Plasmin | Plasmin heavy chain A | Plasmin heavy chain A, short form | Plasmin light chain B
Type:Enzyme
Mol. Mass.:90579.18
Organism:Homo sapiens (human)
Description:n/a
Residue:810
Sequence:
MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFT
CRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKN
GITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILE
CEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRE
LRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWS
AQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTE
QLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAG
LTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEED
CMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGG
PWCYTTNPRKLYDYCDVPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRT
RFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLE
PTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQ
LPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSW
GLGCARPNKPGVYVRVSRFVTWIEGVMRNN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50291006
NameBDBM50291006
Synonyms:4-[2-(1-Carbamimidoyl-2-hydroxy-piperidin-3-ylcarbamoyl)-pyrrolidin-1-yl]-4-oxo-3-phenylmethanesulfonylamino-butyric acid methyl ester | CHEMBL112931
TypeSmall organic molecule
Emp. Form.C23H34N6O7S
Mol. Mass.538.617
SMILESCOC(=O)C[C@H](NS(=O)(=O)Cc1ccccc1)C(=O)N1CCCC1C(=O)N[C@H]1CCCN(C1O)C(N)=N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a