BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD(2) dopamine receptor
LigandBDBM50291347
Substrate/Competitorn/a
Meas. Tech.ChEBML_61131
Ki>1000±n/a nM
Citation Baxter, EWReitz, AB Hindered rotation congeners of mazapertine: High affinity ligands for the 5-HT1A receptor Bioorg Med Chem Lett7:763-768 (1997)    Article
More Info.:Get all data from this article,  Assay Method
 
D(2) dopamine receptor
Name:D(2) dopamine receptor/Metabotropic glutamate receptor 5
Synonyms:DOPAMINE D2 | DOPAMINE D2 Long | DOPAMINE D2 Short | DRD2 | Dopamine D2 receptor | Dopamine D2 receptor (D2) | Dopamine D2 receptor (D2R) | Dopamine D2A | Dopamine2-like
Type:Cell-surface receptors
Mol. Mass.:50647.10
Organism:Homo sapiens (Human)
Description:P14416
Residue:443
Sequence:
MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA
SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQN
ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPL
KGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP
SHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSR
RKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSA
VNPIIYTTFNIEFRKAFLKILHC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50291347
NameBDBM50291347
Synonyms:CHEMBL164330 | Piperidin-1-yl-[3-(3,4,10,10a-tetrahydro-1H-9-oxa-2,4a-diaza-phenanthren-2-ylmethyl)-phenyl]-methanone
TypeSmall organic molecule
Emp. Form.C24H29N3O2
Mol. Mass.391.506
SMILESO=C(N1CCCCC1)c1cccc(CN2CCN3C(COc4ccccc34)C2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a