Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhospholipase A2, acidic
LigandBDBM50015214
Substrate/Competitorn/a
Meas. Tech.ChEMBL_503132
IC50 2160000±n/a nM
Citation Cuélla, MJGiner, RMRecio, MCJust, MJMáñez, SRíos, JL Two fungal lanostane derivatives as phospholipase A2 inhibitors. J Nat Prod59:977-9 (1997) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Phospholipase A2, acidic
Name:Phospholipase A2, acidic
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:13343.23
Organism:Naja naja
Description:ChEMBL_482058
Residue:119
Sequence:
NLYQFKNMIKCTVPSRSWWDFADYGCYCGRGGSGTPVDDLDRCCQVHDNCYNEAEKISGC
WPYFKTYSYECSQGTLTCKGDNNACAASVCDCDRLAAICFAGAPYNDNNYNIDLKARCQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50015214
NameBDBM50015214
Synonyms:6-chloro-2-methoxy-9-acridinyl(4-diethylamino-1-methylbutyl)amine | 6-chloro-N-(5-(diethylamino)pentan-2-yl)-2-methoxyacridin-9-amine | CHEMBL7568 | N'-(6-chloro-2-methoxy-acridin-9-yl)-N,N-diethyl-pentane-1,4-diamine | N*4*-(6-Chloro-2-methoxy-acridin-9-yl)-N*1*,N*1*-diethyl-pentane-1,4-diamine | N*4*-(6-Chloro-2-methoxy-acridin-9-yl)-N*1*,N*1*-diethyl-pentane-1,4-diamine (Mepacrine) | N*4*-(6-Chloro-2-methoxy-acridin-9-yl)-N*1*,N*1*-diethyl-pentane-1,4-diamine ; (mepacrine) | N-(4-Hydroxy-phenyl)-acetamide | cid_237 | quinacrine
TypeSmall organic molecule
Emp. Form.C23H30ClN3O
Mol. Mass.399.957
SMILESCCN(CC)CCCC(C)Nc1c2ccc(Cl)cc2nc2ccc(OC)cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a