BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAldehyde dehydrogenase, cytosolic 1
LigandBDBM50172756
Substrate/Competitorn/a
Meas. Tech.ChEMBL_482174
IC50 300000±n/a nM
Citation Shin, KHWoo, WSLim, SSShim, CSChung, HSKennelly, EJKinghorn, AD Elgonica-Dimers A and B, Two Potent Alcohol Metabolism Inhibitory Constituents of Aloe arborescens J Nat Prod60:1180-1182 (1997)    Article
More Info.:Get all data from this article,  Assay Method
 
Aldehyde dehydrogenase, cytosolic 1
Name:Aldehyde dehydrogenase, cytosolic 1
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:54563.57
Organism:Rattus norvegicus
Description:ChEMBL_482174
Residue:501
Sequence:
MSSPAQPAVPAPLANLKIQHTKIFINNEWHNSLNGKKFPVINPATEEVICHVEEGDKADV
DKAVKAARQAFQIGSPWRTMDASERGCLLNKLADLMERDRVLLATMESMNAGKIFTHAYL
LDTEVSIKALKYFAGWADKIHGQTIPSDGDVFTYTRREPIGVCGQIIPWNGPLILFIWKI
GAALSCGNTVIVKPAEQTPLTALYMASLIKEAGFPPGVVNVVPGYGSTAGAAISSHMDID
KVSFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVFADADLDSAVEFAHQGVFFHQG
QICVAASRLFVEESIYDEFVRRSVERAKKYVLGNPLDSGISQGPQIDKEQHAKILDLIES
GKKEGAKLECGGGRWGNKGFFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSIDEVIKR
ANNTPYGLAAGVFTKDLDRAITVSSALQAGTVWVNCYLTLSVQCPFGGFKMSGNGREMGE
QGVYEYTELKTVAMKISQKNS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50172756
NameBDBM50172756
Synonyms:Benzyl-methyl-prop-2-ynyl-amine | CHEMBL673 | Eutonyl | Eutron | N-benzyl-N-methylprop-2-yn-1-amine | PARGYLINE | US9603833, Pargyline
TypeSmall organic molecule
Emp. Form.C11H13N
Mol. Mass.159.2276
SMILESCN(CC#C)Cc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a