BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAldehyde dehydrogenase, cytosolic 1
LigandBDBM50085551
Substrate/Competitorn/a
Meas. Tech.ChEMBL_482174
IC50 6000±n/a nM
Citation Shin, KHWoo, WSLim, SSShim, CSChung, HSKennelly, EJKinghorn, AD Elgonica-Dimers A and B, Two Potent Alcohol Metabolism Inhibitory Constituents of Aloe arborescens J Nat Prod60:1180-1182 (1997)    Article
More Info.:Get all data from this article,  Assay Method
 
Aldehyde dehydrogenase, cytosolic 1
Name:Aldehyde dehydrogenase, cytosolic 1
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:54563.57
Organism:Rattus norvegicus
Description:ChEMBL_482174
Residue:501
Sequence:
MSSPAQPAVPAPLANLKIQHTKIFINNEWHNSLNGKKFPVINPATEEVICHVEEGDKADV
DKAVKAARQAFQIGSPWRTMDASERGCLLNKLADLMERDRVLLATMESMNAGKIFTHAYL
LDTEVSIKALKYFAGWADKIHGQTIPSDGDVFTYTRREPIGVCGQIIPWNGPLILFIWKI
GAALSCGNTVIVKPAEQTPLTALYMASLIKEAGFPPGVVNVVPGYGSTAGAAISSHMDID
KVSFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVFADADLDSAVEFAHQGVFFHQG
QICVAASRLFVEESIYDEFVRRSVERAKKYVLGNPLDSGISQGPQIDKEQHAKILDLIES
GKKEGAKLECGGGRWGNKGFFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSIDEVIKR
ANNTPYGLAAGVFTKDLDRAITVSSALQAGTVWVNCYLTLSVQCPFGGFKMSGNGREMGE
QGVYEYTELKTVAMKISQKNS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50085551
NameBDBM50085551
Synonyms:1,8-Dihydroxy-3-hydroxymethyl-anthraquinone | 1,8-dihydroxy-3-(hydroxymethyl)anthracene-9,10-dione | CHEMBL40275 | aloe emodin | aloe-emodin | cid_10207
TypeSmall organic molecule
Emp. Form.C15H10O5
Mol. Mass.270.2369
SMILESOCc1cc(O)c2C(=O)c3c(O)cccc3C(=O)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a