Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLeucine aminopeptidase (LAP)
LigandBDBM7459
Substrate/Competitorn/a
Meas. Tech.ChEMBL_546423
IC50 49600±n/a nM
Citation Parellada, JGuinea, M Flavonoid Inhibitors of Trypsin and Leucine Aminopeptidase: A Proposed Mathematical Model for IC50 Estimation J Nat Prod58:823-829 (1995) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Leucine aminopeptidase (LAP)
Name:Leucine aminopeptidase (LAP)
Synonyms:Cytosol aminopeptidase
Type:Enzyme
Mol. Mass.:4015.44
Organism:Sus scrofa (Pig)
Description:P28839
Residue:36
Sequence:
TKGLVLGIYSKEKEDDAPQFTSAGENFDKWVSGKLR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM7459
NameBDBM7459
Synonyms:2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4H-chromen-4-one | 2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-chromen-4-one | CHEMBL151 | Luteolin (27) | Luteolin (4) | cid_5280445 | luteolin
TypeSmall organic molecule
Emp. Form.C15H10O6
Mol. Mass.286.2363
SMILESOc1cc(O)c2c(c1)oc(cc2=O)-c1ccc(O)c(O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a