Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetcPLA2 C2
LigandBDBM50292791
Substrate/Competitorn/a
Meas. Tech.ChEMBL_493930
IC50 6±n/a nM
Citation Chen, LWang, WLee, KLShen, MWMurphy, EAZhang, WXu, XTam, SNickerson-Nutter, CGoodwin, DGClark, JDMcKew, JC Reactions of functionalized sulfonamides: application to lowering the lipophilicity of cytosolic phospholipase A2alpha inhibitors. J Med Chem52:1156-71 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
cPLA2 C2
Name:Cytosolic phospholipase A2
Synonyms:Cytosolic phospholipase A2 | Lysophospholipase | Phosphatidylcholine 2-acylhydrolase | Phospholipase A2 | Phospholipase A2 group IVA | cPLA2
Type:Protein
Mol. Mass.:85219.30
Organism:Homo sapiens (Human)
Description:P47712
Residue:749
Sequence:
MSFIDPYQHIIVEHQYSHKFTVVVLRATKVTKGAFGDMLDTPDPYVELFISTTPDSRKRT
RHFNNDINPVWNETFEFILDPNQENVLEITLMDANYVMDETLGTATFTVSSMKVGEKKEV
PFIFNQVTEMVLEMSLEVCSCPDLRFSMALCDQEKTFRQQRKEHIRESMKKLLGPKNSEG
LHSARDVPVVAILGSGGGFRAMVGFSGVMKALYESGILDCATYVAGLSGSTWYMSTLYSH
PDFPEKGPEEINEELMKNVSHNPLLLLTPQKVKRYVESLWKKKSSGQPVTFTDIFGMLIG
ETLIHNRMNTTLSSLKEKVNTAQCPLPLFTCLHVKPDVSELMFADWVEFSPYEIGMAKYG
TFMAPDLFGSKFFMGTVVKKYEENPLHFLMGVWGSAFSILFNRVLGVSGSQSRGSTMEEE
LENITTKHIVSNDSSDSDDESHEPKGTENEDAGSDYQSDNQASWIHRMIMALVSDSALFN
TREGRAGKVHNFMLGLNLNTSYPLSPLSDFATQDSFDDDELDAAVADPDEFERIYEPLDV
KSKKIHVVDSGLTFNLPYPLILRPQRGVDLIISFDFSARPSDSSPPFKELLLAEKWAKMN
KLPFPKIDPYVFDREGLKECYVFKPKNPDMEKDCPTIIHFVLANINFRKYRAPGVPRETE
EEKEIADFDIFDDPESPFSTFNFQYPNQAFKRLHDLMHFNTLNNIDVIKEAMVESIEYRR
QNPSRCSVSLSNVEARRFFNKEFLSKPKA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50292791
NameBDBM50292791
Synonyms:4-{3-[2-{2-[({2-[(4-Acetylpiperazin-1-yl)methyl]benzyl}sulfonyl)amino]ethyl}-5-chloro-1-(diphenylmethyl)-1H-indol-3-yl]propyl}benzoicAcid | CHEMBL451642
TypeSmall organic molecule
Emp. Form.C47H49ClN4O5S
Mol. Mass.817.434
SMILESCC(=O)N1CCN(Cc2ccccc2CS(=O)(=O)NCCc2c(CCCc3ccc(cc3)C(O)=O)c3cc(Cl)ccc3n2C(c2ccccc2)c2ccccc2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a