Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKinesin-like protein KIF3B
LigandBDBM50293758
Substrate/Competitorn/a
Meas. Tech.ChEMBL_571922
IC50>50000±n/a nM
Citation Lahue, BRMa, YShipps, GWSeghezzi, WHerbst, R Substituted benzimidazoles: A novel chemotype for small molecule hKSP inhibitors. Bioorg Med Chem Lett19:3405-9 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Kinesin-like protein KIF3B
Name:Kinesin-like protein KIF3B
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:85132.22
Organism:Homo sapiens
Description:ChEMBL_571922
Residue:747
Sequence:
MSKLKSSESVRVVVRCRPMNGKEKAASYDKVVDVDVKLGQVSVKNPKGTAHEMPKTFTFD
AVYDWNAKQFELYDETFRPLVDSVLQGFNGTIFAYGQTGTGKTYTMEGIRGDPEKRGVIP
NSFDHIFTHISRSQNQQYLVRASYLEIYQEEIRDLLSKDQTKRLELKERPDTGVYVKDLS
SFVTKSVKEIEHVMNVGNQNRSVGATNMNEHSSRSHAIFVITIECSEVGLDGENHIRVGK
LNLVDLAGSERQAKTGAQGERLKEATKINLSLSALGNVISALVDGKSTHIPYRDSKLTRL
LQDSLGGNAKTVMVANVGPASYNVEETLTTLRYANRAKNIKNKPRVNEDPKDALLREFQE
EIARLKAQLEKRSIGRRKRREKRREGGGSGGGGEEEEEEGEEGEEEGDDKDDYWREQQEK
LEIEKRAIVEDHSLVAEEKMRLLKEKEKKMEDLRREKDAAEMLGAKIKAMESKLLVGGKN
IVDHTNEQQKILEQKRQEIAEQKRREREIQQQMESRDEETLELKETYSSLQQEVDIKTKK
LKKLFSKLQAVKAEIHDLQEEHIKERQELEQTQNELTRELKLKHLIIENFIPLEEKSKIM
NRAFFDEEEDHWKLHPITRLENQQMMKRPVSAVGYKRPLSQHARMSMMIRPEARYRAENI
VLLELDMPSRTTRDYEGPAIAPKVQAALDAALQDEDEIQVDASSFESTANKKSKARPKSG
RKSGSSSSSSGTPASQLYPQSRGLVPK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50293758
n/a
NameBDBM50293758
Synonyms:2-(4-(methylsulfonyl)phenylamino)-1-(2-(trifluoromethyl)benzyl)-1H-benzo[d]imidazole-5-carboxylic acid | CHEMBL562019
TypeSmall organic molecule
Emp. Form.C23H18F3N3O4S
Mol. Mass.489.467
SMILESCS(=O)(=O)c1ccc(Nc2nc3cc(ccc3n2Cc2ccccc2C(F)(F)F)C(O)=O)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: