Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKinesin heavy chain isoform 5A
LigandBDBM50293764
Substrate/Competitorn/a
Meas. Tech.ChEMBL_571923
IC50>50000±n/a nM
Citation Lahue, BRMa, YShipps, GWSeghezzi, WHerbst, R Substituted benzimidazoles: A novel chemotype for small molecule hKSP inhibitors. Bioorg Med Chem Lett19:3405-9 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Kinesin heavy chain isoform 5A
Name:Kinesin heavy chain isoform 5A
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:117363.74
Organism:Homo sapiens
Description:ChEMBL_818702
Residue:1032
Sequence:
MAETNNECSIKVLCRFRPLNQAEILRGDKFIPIFQGDDSVVIGGKPYVFDRVFPPNTTQE
QVYHACAMQIVKDVLAGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIARDIFNHI
YSMDENLEFHIKVSYFEIYLDKIRDLLDVTKTNLSVHEDKNRVPFVKGCTERFVSSPEEI
LDVIDEGKSNRHVAVTNMNEHSSRSHSIFLINIKQENMETEQKLSGKLYLVDLAGSEKVS
KTGAEGAVLDEAKNINKSLSALGNVISALAEGTKSYVPYRDSKMTRILQDSLGGNCRTTM
FICCSPSSYNDAETKSTLMFGQRAKTIKNTASVNLELTAEQWKKKYEKEKEKTKAQKETI
AKLEAELSRWRNGENVPETERLAGEEAALGAELCEETPVNDNSSIVVRIAPEERQKYEEE
IRRLYKQLDDKDDEINQQSQLIEKLKQQMLDQEELLVSTRGDNEKVQRELSHLQSENDAA
KDEVKEVLQALEELAVNYDQKSQEVEEKSQQNQLLVDELSQKVATMLSLESELQRLQEVS
GHQRKRIAEVLNGLMKDLSEFSVIVGNGEIKLPVEISGAIEEEFTVARLYISKIKSEVKS
VVKRCRQLENLQVECHRKMEVTGRELSSCQLLISQHEAKIRSLTEYMQSVELKKRHLEES
YDSLSDELAKLQAQETVHEVALKDKEPDTQDADEVKKALELQMESHREAHHRQLARLRDE
INEKQKTIDELKDLNQKLQLELEKLQADYEKLKSEEHEKSTKLQELTFLYERHEQSKQDL
KGLEETVARELQTLHNLRKLFVQDVTTRVKKSAEMEPEDSGGIHSQKQKISFLENNLEQL
TKVHKQLVRDNADLRCELPKLEKRLRATAERVKALEGALKEAKEGAMKDKRRYQQEVDRI
KEAVRYKSSGKRGHSAQIAKPVRPGHYPASSPTNPYGTRSPECISYTNSLFQNYQNLYLQ
ATPSSTSDMYFANSCTSSGATSSGGPLASYQKANMDNGNATDINDNRSDLPCGYEAEDQA
KLFPLHQETAAS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50293764
n/a
NameBDBM50293764
Synonyms:CHEMBL549531 | methyl 2-(4-(methylthio)phenylamino)-1-(2-(trifluoromethyl)benzyl)-1H-benzo[d]imidazole-5-carboxylate
TypeSmall organic molecule
Emp. Form.C24H20F3N3O2S
Mol. Mass.471.495
SMILESCOC(=O)c1ccc2n(Cc3ccccc3C(F)(F)F)c(Nc3ccc(SC)cc3)nc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: