Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhospholipase A2
LigandBDBM50236230
Substrate/Competitorn/a
Meas. Tech.ChEMBL_573895
Kd 10000±n/a nM
Citation Yu, BZKaimal, RBai, SEl Sayed, KATatulian, SAApitz, RJJain, MKDeng, RBerg, OG Effect of guggulsterone and cembranoids of Commiphora mukul on pancreatic phospholipase A(2): role in hypocholesterolemia. J Nat Prod72:24-8 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Phospholipase A2
Name:Phospholipase A2 group 1B
Synonyms:Group IB phospholipase A2 | Phosphatidylcholine 2-acylhydrolase 1B | Phospholipase A2 (PLA2) | phospholipase A2 precursor
Type:Protein
Mol. Mass.:16364.13
Organism:Homo sapiens (Human)
Description:P04054
Residue:148
Sequence:
MKLLVLAVLLTVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPV
DELDKCCQTHDNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNC
DRNAAICFSKAPYNKAHKNLDTKKYCQS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50236230
NameBDBM50236230
Synonyms:2-((R)-4-((3R,5S,7S,8R,9S,10S,13R,14S,17R)-3,7-dihydroxy-10,13-dimethyl-hexadecahydro-1H-cyclopenta[a]phenanthren-17-yl)pentanamido)ethanesulfonic acid | CHEMBL272427 | ursodeoxy cholic acid
TypeSmall organic molecule
Emp. Form.C26H45NO6S
Mol. Mass.499.704
SMILESC[C@H](CCC(=O)NCCS(O)(=O)=O)[C@H]1CC[C@H]2[C@@H]3[C@@H](O)C[C@@H]4C[C@H](O)CC[C@]4(C)[C@H]3CC[C@]12C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a