Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAntrax lethal toxin
LigandBDBM50294336
Substrate/Competitorn/a
Meas. Tech.ChEMBL_575324
Ki 560±n/a nM
Citation Johnson, SLChen, LHBarile, EEmdadi, ASabet, MYuan, HWei, JGuiney, DPellecchia, M Structure-activity relationship studies of a novel series of anthrax lethal factor inhibitors. Bioorg Med Chem17:3352-68 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Antrax lethal toxin
Name:Antrax lethal toxin
Synonyms:Anthrax lethal factor | lethal factor
Type:PROTEIN
Mol. Mass.:93758.56
Organism:Bacillus anthracis
Description:ChEMBL_1460338
Residue:809
Sequence:
MNIKKEFIKVISMSCLVTAITLSGPVFIPLVQGAGGHGDVGMHVKEKEKNKDENKRKDEE
RNKTQEEHLKEIMKHIVKIEVKGEEAVKKEAAEKLLEKVPSDVLEMYKAIGGKIYIVDGD
ITKHISLEALSEDKKKIKDIYGKDALLHEHYVYAKEGYEPVLVIQSSEDYVENTEKALNV
YYEIGKILSRDILSKINQPYQKFLDVLNTIKNASDSDGQDLLFTNQLKEHPTDFSVEFLE
QNSNEVQEVFAKAFAYYIEPQHRDVLQLYAPEAFNYMDKFNEQEINLSLEELKDQRMLAR
YEKWEKIKQHYQHWSDSLSEEGRGLLKKLQIPIEPKKDDIIHSLSQEEKELLKRIQIDSS
DFLSTEEKEFLKKLQIDIRDSLSEEEKELLNRIQVDSSNPLSEKEKEFLKKLKLDIQPYD
INQRLQDTGGLIDSPSINLDVRKQYKRDIQNIDALLHQSIGSTLYNKIYLYENMNINNLT
ATLGADLVDSTDNTKINRGIFNEFKKNFKYSISSNYMIVDINERPALDNERLKWRIQLSP
DTRAGYLENGKLILQRNIGLEIKDVQIIKQSEKEYIRIDAKVVPKSKIDTKIQEAQLNIN
QEWNKALGLPKYTKLITFNVHNRYASNIVESAYLILNEWKNNIQSDLIKKVTNYLVDGNG
RFVFTDITLPNIAEQYTHQDEIYEQVHSKGLYVPESRSILLHGPSKGVELRNDSEGFIHE
FGHAVDDYAGYLLDKNQSDLVTNSKKFIDIFKEEGSNLTSYGRTNEAEFFAEAFRLMHST
DHAERLKVQKNAPKTFQFINDQIKFIINS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50294336
NameBDBM50294336
Synonyms:5-amino-2-(4-aminophenylamino)benzenesulfonic acid | CHEMBL560968
TypeSmall organic molecule
Emp. Form.C12H13N3O3S
Mol. Mass.279.315
SMILESNc1ccc(Nc2ccc(N)cc2S(O)(=O)=O)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a