Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCalcitonin gene-related peptide type 1 receptor
LigandBDBM50296789
Substrate/Competitorn/a
Meas. Tech.ChEMBL_582534
Ki 0.28±n/a nM
Citation Bell, IMBednar, RACorcoran, HAFay, JFGallicchio, SNJohnston, VKHershey, JCMiller-Stein, CMMoore, ELMosser, SDRoller, SASalvatore, CATheberge, CRWong, BKBlair Zartman, CKane, SAWilliams, TMGraham, SLVacca, JP The identification of potent, orally bioavailable tricyclic CGRP receptor antagonists. Bioorg Med Chem Lett19:4740-2 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Calcitonin gene-related peptide type 1 receptor
Name:Adrenomedullin receptor AM1; CALCRL/RAMP2
Synonyms:Calcitonin gene-related peptide (CGRP) receptor | Calcitonin gene-related peptide 1 (CGRP) | Calcitonin receptor-like receptor
Type:Enzyme
Mol. Mass.:52931.38
Organism:Homo sapiens (Human)
Description:Q16602
Residue:461
Sequence:
MEKKCTLNFLVLLPFFMILVTAELEESPEDSIQLGVTRNKIMTAQYECYQKIMQDPIQQA
EGVYCNRTWDGWLCWNDVAAGTESMQLCPDYFQDFDPSEKVTKICDQDGNWFRHPASNRT
WTNYTQCNVNTHEKVKTALNLFYLTIIGHGLSIASLLISLGIFFYFKSLSCQRITLHKNL
FFSFVCNSVVTIIHLTAVANNQALVATNPVSCKVSQFIHLYLMGCNYFWMLCEGIYLHTL
IVVAVFAEKQHLMWYYFLGWGFPLIPACIHAIARSLYYNDNCWISSDTHLLYIIHGPICA
ALLVNLFFLLNIVRVLITKLKVTHQAESNLYMKAVRATLILVPLLGIEFVLIPWRPEGKI
AEEVYDYIMHILMHFQGLLVSTIFCFFNGEVQAILRRNWNQYKIQFGNSFSNSEALRSAS
YTVSTISDGPGYSHDCPSEHLNGKSIHDIENVLLKPENLYN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50296789
NameBDBM50296789
Synonyms:2-(2a-methyl-4-oxo-2a,3,4,5-tetrahydropyrrolo[4,3,2-de]quinolin-1(2H)-yl)-N-((S)-2'-oxo-1,1',2',3-tetrahydrospiro[indene-2,3'-pyrrolo[2,3-b]pyridine]-5-yl)acetamide | CHEMBL564487
TypeSmall organic molecule
Emp. Form.C28H25N5O3
Mol. Mass.479.5298
SMILESCC12CN(CC(=O)Nc3ccc4C[C@@]5(Cc4c3)C(=O)Nc3ncccc53)c3cccc(NC(=O)C1)c23 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a