Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAKT/p21CIP1
LigandBDBM50298443
Substrate/Competitorn/a
Meas. Tech.ChEMBL_587680
IC50 0.17±n/a nM
Citation Dong, XJiang, CHu, HYan, JChen, JHu, Y QSAR study of Akt/protein kinase B (PKB) inhibitors using support vector machine. Eur J Med Chem44:4090-7 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
AKT/p21CIP1
Name:AKT/p21CIP1
Synonyms:AKT phosphorylation (p-AKT) | C-AKT | PKB | PKB alpha | Protein kinase Akt-1 | Protein kinase B | Protein kinase B (AKT1) | Protein kinase B (Akt 1) | Protein kinase B (Akt) | Protein kinase B alpha | Protein kinase B alpha (AKT1) | Proto-oncogene Akt (Akt1) | Proto-oncogene c-Akt (AKT) | RAC-PK-alpha | RAC-alpha serine/threonine-protein kinase (AKT) | RAC-alpha serine/threonine-protein kinase (AKT1) | RAC-alpha serine/threonine-protein kinase (pAKT)
Type:Enzyme
Mol. Mass.:55681.25
Organism:Homo sapiens (human)
Description:n/a
Residue:480
Sequence:
MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDF
RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50298443
NameBDBM50298443
Synonyms:5-(5-((S)-2-amino-3-(1H-indol-3-yl)propoxy)pyridin-3-yl)-3-(furan-2-yl)indolin-2-one | CHEMBL573326
TypeSmall organic molecule
Emp. Form.C28H24N4O3
Mol. Mass.464.5152
SMILESN[C@H](COc1cncc(c1)-c1ccc2NC(=O)C(c3ccco3)c2c1)Cc1c[nH]c2ccccc12 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a