Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetStearoyl-CoA desaturase 1 (SCD1)
LigandBDBM50257967
Substrate/Competitorn/a
Meas. Tech.ChEMBL_588105
IC50 0.6±n/a nM
Citation Koltun, DOZilbershtein, TMMigulin, VAVasilevich, NIParkhill, EQGlushkov, AIMcGregor, MJBrunn, SAChu, NHao, JMollova, NLeung, KChisholm, JWZablocki, J Potent, orally bioavailable, liver-selective stearoyl-CoA desaturase (SCD) inhibitors. Bioorg Med Chem Lett19:4070-4 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Stearoyl-CoA desaturase 1 (SCD1)
Name:Stearoyl-CoA desaturase 1 (SCD1)
Synonyms:Acyl-CoA desaturase 1
Type:Enzyme
Mol. Mass.:41485.97
Organism:Rattus norvegicus (Rat)
Description:P07308
Residue:358
Sequence:
MPAHMLQEISSSYTTTTTITEPPSGNLQNGREKMKKVPLYLEEDIRPEMREDIHDPSYQD
EEGPPPKLEYVWRNIILMALLHVGALYGITLIPSSKVYTLLWGIFYYLISALGITAGAHR
LWSHRTYKARLPLRIFLIIANTMAFQNDVYEWARDHRAHHKFSETHADPHNSRRGFFFSH
VGWLLVRKHPAVKEKGGKLDMSDLKAEKLVMFQRRYYKPGLLLMCFILPTLVPWYCWGET
FLHSLFVSTFLRYTLVLNATWLVNSAAHLYGYRPYDKNIQSRENILVSLGAVGEGFHNYH
HAFPYDYSASEYRWHINFTTFFIDCMAALGLAYDRKKVSKAAVLARIKRTGDGSHKSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50257967
NameBDBM50257967
Synonyms:CHEMBL494748 | N-(2-(7-(4-chloro-3-(trifluoromethyl)benzylamino)-3-(4-methoxyphenyl)-2-oxoquinoxalin-1(2H)-yl)ethyl)acetamide
TypeSmall organic molecule
Emp. Form.C27H24ClF3N4O3
Mol. Mass.544.953
SMILESCOc1ccc(cc1)-c1nc2ccc(NCc3ccc(Cl)c(c3)C(F)(F)F)cc2n(CCNC(C)=O)c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a