Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhosphodiesterase 9A
LigandBDBM50300101
Substrate/Competitorn/a
Meas. Tech.ChEMBL_593497
IC50 66±n/a nM
Citation Verhoest, PRProulx-Lafrance, CCorman, MChenard, LHelal, CJHou, XKleiman, RLiu, SMarr, EMenniti, FSSchmidt, CJVanase-Frawley, MSchmidt, AWWilliams, RDNelson, FRFonseca, KRLiras, S Identification of a brain penetrant PDE9A inhibitor utilizing prospective design and chemical enablement as a rapid lead optimization strategy. J Med Chem52:7946-9 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Phosphodiesterase 9A
Name:Phosphodiesterase 9A
Synonyms:High affinity cGMP-specific 3'',5''-cyclic phosphodiesterase 9A | Phosphodiesterase 9A (PDE9) | Phosphodiesterase 9A (PDE9A)
Type:Protein
Mol. Mass.:68488.40
Organism:Homo sapiens (human)
Description:O76083
Residue:593
Sequence:
MGSGSSSYRPKAIYLDIDGRIQKVIFSKYCNSSDIMDLFCIATGLPRNTTISLLTTDDAM
VSIDPTMPANSERTPYKVRPVAIKQLSAGVEDKRTTSRGQSAERPLRDRRVVGLEQPRRE
GAFESGQVEPRPREPQGCYQEGQRIPPEREELIQSVLAQVAEQFSRAFKINELKAEVANH
LAVLEKRVELEGLKVVEIEKCKSDIKKMREELAARSSRTNCPCKYSFLDNHKKLTPRRDV
PTYPKYLLSPETIEALRKPTFDVWLWEPNEMLSCLEHMYHDLGLVRDFSINPVTLRRWLF
CVHDNYRNNPFHNFRHCFCVAQMMYSMVWLCSLQEKFSQTDILILMTAAICHDLDHPGYN
NTYQINARTELAVRYNDISPLENHHCAVAFQILAEPECNIFSNIPPDGFKQIRQGMITLI
LATDMARHAEIMDSFKEKMENFDYSNEEHMTLLKMILIKCCDISNEVRPMEVAEPWVDCL
LEEYFMQSDREKSEGLPVAPFMDRDKVTKATAQIGFIKFVLIPMFETVTKLFPMVEEIML
QPLWESRDRYEELKRIDDAMKELQKKTDSLTSGATEKSRERSRDVKNSEGDCA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50300101
NameBDBM50300101
Synonyms:6-[(3,4-trans)-1-benzyl-4-methylpyrrolidin-3-yl]-1-cyclopentyl-15-dihydro-4H-pyrazolo[34-d]pyrimidin-4-one | 6-[(3S,4S)-1-benzyl-4-methylpyrrolidin-3-yl]-1-(1-methylethyl)-1,5-dihydro-4H-pyrazolo[3,4-d]pyrimidin-4-one | CHEMBL572517
TypeSmall organic molecule
Emp. Form.C20H25N5O
Mol. Mass.351.4454
SMILESCC(C)n1ncc2c1nc([nH]c2=O)[C@@H]1CN(Cc2ccccc2)C[C@H]1C |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a