Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetE3 ubiquitin-protein ligase Mdm2
LigandBDBM50300114
Substrate/Competitorn/a
Meas. Tech.ChEMBL_593610
Ki 0.6±n/a nM
Citation Yu, SQin, DShangary, SChen, JWang, GDing, KMcEachern, DQiu, SNikolovska-Coleska, ZMiller, RKang, SYang, DWang, S Potent and orally active small-molecule inhibitors of the MDM2-p53 interaction. J Med Chem52:7970-3 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
E3 ubiquitin-protein ligase Mdm2
Name:MDM2-MDMX
Synonyms:Double minute 2 protein | Double minute 2 protein (HDM2) | E3 ubiquitin-protein ligase Mdm2 (p53-binding protein Mdm2) | Hdm2 | Human Double Minute 2 (HDM2) | p53-Binding Protein MDM2 | p53-binding protein
Type:Oncoprotein
Mol. Mass.:55196.54
Organism:Homo sapiens (Human)
Description:n/a
Residue:491
Sequence:
MCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQY
IMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQESSDSGT
SVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDELSGERQ
RKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGDWLDQDS
VSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYQVTVYQAGESDTDSFEEDPEISLA
DYWKCTSCNEMNPPLPSHCNRCWALRENWLPEDKGKDKGEISEKAKLENSTQAEEGFDVP
DCKKTIVNDSRESCVEENDDKITQASQSQESEDYSQPSTSSSIIYSSQEDVKEFEREETQ
DKEESVESSLPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQ
PIQMIVLTYFP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50300114
NameBDBM50300114
Synonyms:(2'R,3S,4'S,5'R)-6-chloro-4'-(3-chloro-2-fluorophenyl)-N-((S)-3,4-dihydroxybutyl)-2'-neopentyl-2-oxospiro[indoline-3,3'-pyrrolidine]-5'-carboxamide | CHEMBL578028
TypeSmall organic molecule
Emp. Form.C27H32Cl2FN3O4
Mol. Mass.552.465
SMILESCC(C)(C)C[C@H]1N[C@H]([C@H](c2cccc(Cl)c2F)[C@@]11C(=O)Nc2cc(Cl)ccc12)C(=O)NCC[C@H](O)CO |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a