Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin (5-HT) receptor
LigandBDBM50304075
Substrate/Competitorn/a
Meas. Tech.ChEMBL_601692
IC50>10000±n/a nM
Citation Peng, YZhang, QArora, SKeenan, SMKortagere, SWannemacher, KMHowells, RDWelsh, WJ Novel delta opioid receptor agonists exhibit differential stimulation of signaling pathways. Bioorg Med Chem17:6442-50 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serotonin (5-HT) receptor
Name:Serotonin (5-HT) receptor
Synonyms:5-HT-1E | 5-HT1E | 5-Hydroxytryptamine Receptor Subtype 1E (5HT1E) | 5-hydroxytryptamine receptor 1E | 5-hydroxytryptamine receptor 1E (5-HT-1E) (S31) | 5-hydroxytryptamine receptor 1E (5-HT-1E) (Serotonin receptor 1E) (5-HT1E) (S31). | S31 | Serotonin 1e (5-HT1e) receptor | Serotonin Receptor 1E
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:41697.80
Organism:Homo sapiens (Human)
Description:gi_112822
Residue:365
Sequence:
MNITNCTTEASMAIRPKTITEKMLICMTLVVITTLTTLLNLAVIMAIGTTKKLHQPANYL
ICSLAVTDLLVAVLVMPLSIIYIVMDRWKLGYFLCEVWLSVDMTCCTCSILHLCVIALDR
YWAITNAIEYARKRTAKRAALMILTVWTISIFISMPPLFWRSHRRLSPPPSQCTIQHDHV
IYTIYSTLGAFYIPLTLILILYYRIYHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKLTQ
TFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPGERQQISSTRERKAARILGLILGAF
ILSWLPFFIKELIVGLSIYTVSSEVADFLTWLGYVNSLINPLLYTSFNEDFKLAFKKLIR
CREHT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50304075
NameBDBM50304075
Synonyms:3-(5-(4-tert-butylphenyl)-3-((dimethylamino)methyl)-1H-1,2,4-triazol-1-yl)phenol | CHEMBL595449
TypeSmall organic molecule
Emp. Form.C21H26N4O
Mol. Mass.350.4573
SMILESCN(C)Cc1nc(-c2ccc(cc2)C(C)(C)C)n(n1)-c1cccc(O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a