Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDelta-type opioid receptor
LigandBDBM50304084
Substrate/Competitorn/a
Meas. Tech.ChEMBL_601677
IC50 29±n/a nM
Citation Peng, YZhang, QArora, SKeenan, SMKortagere, SWannemacher, KMHowells, RDWelsh, WJ Novel delta opioid receptor agonists exhibit differential stimulation of signaling pathways. Bioorg Med Chem17:6442-50 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Delta-type opioid receptor
Name:Delta-type opioid receptor
Synonyms:DOR-1 | K56 | MSL-2 | OPIATE Delta | OPRD1
Type:Enzyme Catalytic Domain
Mol. Mass.:40577.25
Organism:MOUSE
Description:P32300
Residue:372
Sequence:
MELVPSARAELQSSPLVNLSDAFPSAFPSAGANASGSPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTQPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRTPCGRQEPGSLRRPRQATTRERVTAC
TPSDGPGGGAAA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50304084
NameBDBM50304084
Synonyms:3-(2-(3-tert-Butylphenyl)-5-((dimethylamino)methyl)-2H-1,2,4-triazol-3-yl)phenol | CHEMBL605510
TypeSmall organic molecule
Emp. Form.C21H26N4O
Mol. Mass.350.4573
SMILESCN(C)Cc1nc(-c2cccc(O)c2)n(n1)-c1cccc(c1)C(C)(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a