Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLysophosphatidic acid receptor 3 (LPAR3)
LigandBDBM50304581
Substrate/Competitorn/a
Meas. Tech.ChEMBL_605127
Ki 1084±n/a nM
Citation Fells, JITsukahara, RLiu, JTigyi, GParrill, AL Structure-based drug design identifies novel LPA3 antagonists. Bioorg Med Chem17:7457-64 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Lysophosphatidic acid receptor 3 (LPAR3)
Name:Lysophosphatidic acid receptor 1/3
Synonyms:Lysophosphatidic acid receptor Edg-7
Type:Enzyme
Mol. Mass.:40149.72
Organism:Homo sapiens (Human)
Description:Q9UBY5
Residue:353
Sequence:
MNECHYDKHMDFFYNRSNTDTVDDWTGTKLVIVLCVGTFFCLFIFFSNSLVIAAVIKNRK
FHFPFYYLLANLAAADFFAGIAYVFLMFNTGPVSKTLTVNRWFLRQGLLDSSLTASLTNL
LVIAVERHMSIMRMRVHSNLTKKRVTLLILLVWAIAIFMGAVPTLGWNCLCNISACSSLA
PIYSRSYLVFWTVSNLMAFLIMVVVYLRIYVYVKRKTNVLSPHTSGSISRRRTPMKLMKT
VMTVLGAFVVCWTPGLVVLLLDGLNCRQCGVQHVKRWFLLLALLNSVVNPIIYSYKDEDM
YGTMKKMICCFSQENPERRPSRIPSTVLSRSDTGSQYIEDSISQGAVCNKSTS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50304581
NameBDBM50304581
Synonyms:2-(1,3-dioxo-5-(p-tolyloxy)isoindolin-2-yl)acetic acid | CHEMBL607806
TypeSmall organic molecule
Emp. Form.C17H13NO5
Mol. Mass.311.2888
SMILESCc1ccc(Oc2ccc3C(=O)N(CC(O)=O)C(=O)c3c2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a