Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCalmodulin-sensitive adenylate cyclase
LigandBDBM50206817
Substrate/Competitorn/a
Meas. Tech.ChEMBL_606615
Ki 980±n/a nM
Citation Emmrich, TEl-Tayeb, ATaha, HSeifert, RMüller, CELink, A Synthesis of a hydrolytically stable, fluorescent-labeled ATP analog as a tool for probing adenylyl cyclases. Bioorg Med Chem Lett20:232-5 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Calmodulin-sensitive adenylate cyclase
Name:Calmodulin-sensitive adenylate cyclase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:92481.33
Organism:Bacillus anthracis
Description:ChEMBL_606615
Residue:800
Sequence:
MTRNKFIPNKFSIISFSVLLFAISSSQAIEVNAMNEHYTESDIKRNHKTEKNKTEKEKFK
DSINNLVKTEFTNETLDKIQQTQDLLKKIPKDVLEIYSELGGEIYFTDIDLVEHKELQDL
SEEEKNSMNSRGEKVPFASRFVFEKKRETPKLIINIKDYAINSEQSKEVYYEIGKGISLD
IISKDKSLDPEFLNLIKSLSDDSDSSDLLFSQKFKEKLELNNKSIDINFIKENLTEFQHA
FSLAFSYYFAPDHRTVLELYAPDMFEYMNKLEKGGFEKISESLKKEGVEKDRIDVLKGEK
ALKASGLVPEHADAFKKIARELNTYILFRPVNKLATNLIKSGVATKGLNVHGKSSDWGPV
AGYIPFDQDLSKKHGQQLAVEKGNLENKKSITEHEGEIGKIPLKLDHLRIEELKENGIIL
KGKKEIDNGKKYYLLESNNQVYEFRISDENNEVQYKTKEGKITVLGEKFNWRNIEVMAKN
VEGVLKPLTADYDLFALAPSLTEIKKQIPQKEWDKVVNTPNSLEKQKGVTNLLIKYGIER
KPDSTKGTLSNWQKQMLDRLNEAVKYTGYTGGDVVNHGTEQDNEEFPEKDNEIFIINPEG
EFILTKNWEMTGRFIEKNITGKDYLYYFNRSYNKIAPGNKAYIEWTDPITKAKINTIPTS
AEFIKNLSSIRRSSNVGVYKDSGDKDEFAKKESVKKIAGYLSDYYNSANHIFSQEKKRKI
SIFRGIQAYNEIENVLKSKQIAPEYKNYFQYLKERITNQVQLLLTHQKSNIEFKLLYKQL
NFTENETDNFEVFQKIIDEK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50206817
NameBDBM50206817
Synonyms:(2R,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-4-hydroxy-2-((hydroxy(hydroxy(phosphonooxy)phosphoryloxy)phosphoryloxy)methyl)tetrahydrofuran-3-yl 2-(methylamino)benzoate | 3'-O-[2-(METHYLAMINO)BENZOYL]ADENOSINE 5'-(TETRAHYDROGEN TRIPHOSPHATE) | CHEMBL254869 | MANT-ATP
TypeSmall organic molecule
Emp. Form.C18H23N6O14P3
Mol. Mass.640.3283
SMILESCNc1ccccc1C(=O)O[C@@H]1[C@@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)O[C@H]([C@@H]1O)n1cnc2c(N)ncnc12 |w:15.16,19.20|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a