Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDeath-associated protein kinase 3
LigandBDBM50305006
Substrate/Competitorn/a
Meas. Tech.ChEMBL_606949
IC50 4300±n/a nM
Citation Harris, CMEricsson, AMArgiriadi, MABarberis, CBorhani, DWBurchat, ACalderwood, DJCunha, GADixon, RWFrank, KEJohnson, EFKamens, JKwak, SLi, BMullen, KDPerron, DCWang, LWishart, NWu, XZhang, XZmetra, TRTalanian, RV 2,4-Diaminopyrimidine MK2 inhibitors. Part II: Structure-based inhibitor optimization. Bioorg Med Chem Lett20:334-7 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Death-associated protein kinase 3
Name:Death-associated protein kinase 3
Synonyms:DAP kinase 3 | DAP-like kinase | DAPK3 | ZIP-kinase
Type:PROTEIN
Mol. Mass.:52537.07
Organism:Homo sapiens (Human)
Description:ChEMBL_586564
Residue:454
Sequence:
MSTFRQEDVEDHYEMGEELGSGQFAIVRKCRQKGTGKEYAAKFIKKRRLSSSRRGVSREE
IEREVNILREIRHPNIITLHDIFENKTDVVLILELVSGGELFDFLAEKESLTEDEATQFL
KQILDGVHYLHSKRIAHFDLKPENIMLLDKNVPNPRIKLIDFGIAHKIEAGNEFKNIFGT
PEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGETKQETLTNISAVNYDFDEEY
FSNTSELAKDFIRRLLVKDPKRRMTIAQSLEHSWIKAIRRRNVRGEDSGRKPERRRLKTT
RLKEYTIKSHSSLPPNNSYADFERFSKVLEEAAAAEEGLRELQRSRRLCHEDVEALAAIY
EEKEAWYREESDSLGQDLRRLRQELLKTEALKRQAQEEAKGALLGTSGLKRRFSRLENRY
EALAKQVASEMRFVQDLVRALEQEKLQGVECGLR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50305006
NameBDBM50305006
Synonyms:5-(2-aminoethyl)-7-(7-(benzo[b]thiophen-2-yl)-1H-indazol-5-yl)-5H-pyrrolo[3,2-d]pyrimidin-2-amine | CHEMBL590109
TypeSmall organic molecule
Emp. Form.C23H19N7S
Mol. Mass.425.509
SMILESNCCn1cc(-c2cc(-c3cc4ccccc4s3)c3[nH]ncc3c2)c2nc(N)ncc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a