Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLiver X receptor (LXR alpha AND LXR beta)
LigandBDBM50305073
Substrate/Competitorn/a
Meas. Tech.ChEMBL_603036
IC50 1.2±n/a nM
Citation Bernotas, RCSinghaus, RRKaufman, DHTravins, JMUllrich, JWUnwalla, RQuinet, EEvans, MNambi, POlland, AKauppi, BWilhelmsson, AGoos-Nilsson, AWrobel, J 4-(3-Aryloxyaryl)quinoline sulfones are potent liver X receptor agonists. Bioorg Med Chem Lett20:209-12 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Liver X receptor (LXR alpha AND LXR beta)
Name:Liver X receptor (LXR alpha AND LXR beta)
Synonyms:Liver X Receptor alpha (LXR-alpha) | Liver X receptor alpha | Liver X receptor alpha (LXRA) | Liver X receptor alpha (NR1H3) | Liver X, LXR alpha | Nuclear orphan receptor LXR-alpha | Nuclear receptor subfamily 1 group H member 3 | Oxysterols receptor LXR-alpha
Type:Receptor
Mol. Mass.:50403.85
Organism:Homo sapiens (Human)
Description:His-tagged hLXR.
Residue:447
Sequence:
MSLWLGAPVPDIPPDSAVELWKPGAQDASSQAQGGSSCILREEARMPHSAGGTAGVGLEA
AEPTALLTRAEPPSEPTEIRPQKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKG
FFRRSVIKGAHYICHSGGHCPMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKLK
RQEEEQAHATSLPPRASSPPQILPQLSPEQLGMIEKLVAAQQQCNRRSFSDRLRVTPWPM
APDPHSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLL
ETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLI
AISIFSADRPNVQDQLQVERLQHTYVEALHAYVSIHHPHDRLMFPRMLMKLVSLRTLSSV
HSEQVFALRLQDKKLPPLLSEIWDVHE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50305073
NameBDBM50305073
Synonyms:3-benzyl-8-chloro-4-(3-(3-(methylsulfonyl)phenoxy)phenyl)quinoline | CHEMBL606539
TypeSmall organic molecule
Emp. Form.C29H22ClNO3S
Mol. Mass.500.008
SMILESCS(=O)(=O)c1cccc(Oc2cccc(c2)-c2c(Cc3ccccc3)cnc3c(Cl)cccc23)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a