Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLiver X receptor (LXR alpha AND LXR beta)
LigandBDBM50306080
Substrate/Competitorn/a
Meas. Tech.ChEMBL_605982
IC50 3.5±n/a nM
Citation Travins, JMBernotas, RCKaufman, DHQuinet, ENambi, PFeingold, IHuselton, CWilhelmsson, AGoos-Nilsson, AWrobel, J 1-(3-Aryloxyaryl)benzimidazole sulfones are liver X receptor agonists. Bioorg Med Chem Lett20:526-30 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Liver X receptor (LXR alpha AND LXR beta)
Name:Liver X receptor (LXR alpha AND LXR beta)
Synonyms:Liver X Receptor alpha (LXR-alpha) | Liver X receptor alpha | Liver X receptor alpha (LXRA) | Liver X receptor alpha (NR1H3) | Liver X, LXR alpha | Nuclear orphan receptor LXR-alpha | Nuclear receptor subfamily 1 group H member 3 | Oxysterols receptor LXR-alpha
Type:Receptor
Mol. Mass.:50403.85
Organism:Homo sapiens (Human)
Description:His-tagged hLXR.
Residue:447
Sequence:
MSLWLGAPVPDIPPDSAVELWKPGAQDASSQAQGGSSCILREEARMPHSAGGTAGVGLEA
AEPTALLTRAEPPSEPTEIRPQKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKG
FFRRSVIKGAHYICHSGGHCPMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKLK
RQEEEQAHATSLPPRASSPPQILPQLSPEQLGMIEKLVAAQQQCNRRSFSDRLRVTPWPM
APDPHSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLL
ETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLI
AISIFSADRPNVQDQLQVERLQHTYVEALHAYVSIHHPHDRLMFPRMLMKLVSLRTLSSV
HSEQVFALRLQDKKLPPLLSEIWDVHE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50306080
NameBDBM50306080
Synonyms:4-chloro-1-(2-chloro-5-(3-(ethylsulfonyl)phenoxy)phenyl)-2-methyl-1H-benzo[d]imidazole | CHEMBL595249
TypeSmall organic molecule
Emp. Form.C22H18Cl2N2O3S
Mol. Mass.461.361
SMILESCCS(=O)(=O)c1cccc(Oc2ccc(Cl)c(c2)-n2c(C)nc3c(Cl)cccc23)c1 |(3.48,-43.65,;2.14,-44.41,;.82,-43.64,;1.9,-42.55,;-.28,-42.55,;-.5,-44.43,;-.48,-45.97,;-1.81,-46.75,;-3.15,-46,;-3.15,-44.46,;-4.49,-43.71,;-5.82,-44.49,;-7.16,-43.73,;-8.5,-44.52,;-8.48,-46.06,;-9.8,-46.84,;-7.14,-46.81,;-5.8,-46.03,;-7.12,-48.35,;-6.22,-49.6,;-4.68,-49.6,;-7.12,-50.85,;-8.59,-50.37,;-9.92,-51.15,;-9.91,-52.69,;-11.26,-50.38,;-11.26,-48.84,;-9.92,-48.07,;-8.59,-48.83,;-1.84,-43.68,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a