Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD(1A) dopamine receptor
LigandBDBM50306325
Substrate/Competitorn/a
Meas. Tech.ChEMBL_609554
Ki 0.7±n/a nM
Citation Qiang, LSasikumar, TKBurnett, DASu, JTang, HYe, YMazzola, RDZhu, ZMcKittrick, BAGreenlee, WJFawzi, ASmith, MZhang, HLachowicz, JE Discovery of new SCH 39166 analogs as potent and selective dopamine D1 receptor antagonists. Bioorg Med Chem Lett20:836-40 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
D(1A) dopamine receptor
Name:Dopamine D1 and D2 receptor
Synonyms:DA D1 receptor | DOPAMINE D1 | DRD1 | Dopamine D1 receptor | Dopamine D1 receptor (D1R) | Dopamine D1A
Type:Enzyme
Mol. Mass.:49303.43
Organism:Homo sapiens (Human)
Description:P21728
Residue:446
Sequence:
MRTLNTSAMDGTGLVVERDFSVRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTN
FFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGSFCNIWVAFDIMCSTASILNLCVISVD
RYWAISSPFRYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTSPSDGNATSLA
ETIDNCDSSLSRTYAISSSVISFYIPVAIMIVTYTRIYRIAQKQIRRIAALERAAVHAKN
CQTTTGNGKPVECSQPESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCILPFCGS
GETQPFCIDSNTFDVFVWFGWANSSLNPIIYAFNADFRKAFSTLLGCYRLCPATNNAIET
VSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPAL
SVILDYDTDVSLEKIQPITQNGQHPT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50306325
NameBDBM50306325
Synonyms:1-((6aS,13bR)-11-chloro-12-hydroxy-7-methyl-6,6a,7,8,9,13b-hexahydro-5H-benzo[d]naphtho[2,1-b]azepin-3-yl)-3-(2,6-dichlorophenyl)urea | CHEMBL599977
TypeSmall organic molecule
Emp. Form.C26H24Cl3N3O2
Mol. Mass.516.847
SMILESCN1CCc2cc(Cl)c(O)cc2[C@@H]2[C@@H]1CCc1cc(NC(=O)Nc3c(Cl)cccc3Cl)ccc21 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a