Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAnandamide amidohydrolase
LigandBDBM50308965
Substrate/Competitorn/a
Meas. Tech.ChEMBL_611783
IC50>10000±n/a nM
Citation Forster, LLudwig, JKaptur, MBovens, SElfringhoff, ASHoltfrerich, ALehr, M 1-Indol-1-yl-propan-2-ones and related heterocyclic compounds as dual inhibitors of cytosolic phospholipase A(2)alpha and fatty acid amide hydrolase. Bioorg Med Chem18:945-52 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Anandamide amidohydrolase
Name:Anandamide amidohydrolase
Synonyms:Anandamide amidohydrolase 1 | FAAH | Fatty Acid Amide Hydrolase | Fatty Acid Amide Hydrolic, FAAH | Fatty-acid amide hydrolase (FAAH) | Fatty-acid amide hydrolase 1 | Fatty-acid amide hydrolase 1 (FAAH) | Oleamide hydrolase 1
Type:Single-pass membrane protein; homodimer
Mol. Mass.:63364.46
Organism:Rattus norvegicus (rat)
Description:Membranes prepared from rat brain were used in assay.
Residue:579
Sequence:
MVLSEVWTTLSGVSGVCLACSLLSAAVVLRWTGRQKARGAATRARQKQRASLETMDKAVQ
RFRLQNPDLDSEALLTLPLLQLVQKLQSGELSPEAVFFTYLGKAWEVNKGTNCVTSYLTD
CETQLSQAPRQGLLYGVPVSLKECFSYKGHDSTLGLSLNEGMPSESDCVVVQVLKLQGAV
PFVHTNVPQSMLSFDCSNPLFGQTMNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGG
SIRFPSAFCGICGLKPTGNRLSKSGLKGCVYGQTAVQLSLGPMARDVESLALCLKALLCE
HLFTLDPTVPPLPFREEVYRSSRPLRVGYYETDNYTMPSPAMRRALIETKQRLEAAGHTL
IPFLPNNIPYALEVLSAGGLFSDGGRSFLQNFKGDFVDPCLGDLILILRLPSWFKRLLSL
LLKPLFPRLAAFLNSMRPRSAEKLWKLQHEIEMYRQSVIAQWKAMNLDVLLTPMLGPALD
LNTPGRATGAISYTVLYNCLDFPAGVVPVTTVTAEDDAQMELYKGYFGDIWDIILKKAMK
NSVGLPVAVQCVALPWQEELCLRFMREVEQLMTPQKQPS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50308965
NameBDBM50308965
Synonyms:1-(3-(4-octylphenoxy)-2-oxopropyl)-1H-indole-5-carbonitrile | 1-[3-(4-octylphenoxy)-2-oxopropyl]indole-5-carbonitrile | CHEMBL207595
TypeSmall organic molecule
Emp. Form.C26H30N2O2
Mol. Mass.402.5286
SMILESCCCCCCCCc1ccc(OCC(=O)Cn2ccc3cc(ccc23)C#N)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a