Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetcPLA2 C2
LigandBDBM50185357
Substrate/Competitorn/a
Meas. Tech.ChEMBL_611785
IC50 4300±n/a nM
Citation Forster, LLudwig, JKaptur, MBovens, SElfringhoff, ASHoltfrerich, ALehr, M 1-Indol-1-yl-propan-2-ones and related heterocyclic compounds as dual inhibitors of cytosolic phospholipase A(2)alpha and fatty acid amide hydrolase. Bioorg Med Chem18:945-52 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
cPLA2 C2
Name:Cytosolic phospholipase A2
Synonyms:Cytosolic phospholipase A2 | Lysophospholipase | Phosphatidylcholine 2-acylhydrolase | Phospholipase A2 | Phospholipase A2 group IVA | cPLA2
Type:Protein
Mol. Mass.:85219.30
Organism:Homo sapiens (Human)
Description:P47712
Residue:749
Sequence:
MSFIDPYQHIIVEHQYSHKFTVVVLRATKVTKGAFGDMLDTPDPYVELFISTTPDSRKRT
RHFNNDINPVWNETFEFILDPNQENVLEITLMDANYVMDETLGTATFTVSSMKVGEKKEV
PFIFNQVTEMVLEMSLEVCSCPDLRFSMALCDQEKTFRQQRKEHIRESMKKLLGPKNSEG
LHSARDVPVVAILGSGGGFRAMVGFSGVMKALYESGILDCATYVAGLSGSTWYMSTLYSH
PDFPEKGPEEINEELMKNVSHNPLLLLTPQKVKRYVESLWKKKSSGQPVTFTDIFGMLIG
ETLIHNRMNTTLSSLKEKVNTAQCPLPLFTCLHVKPDVSELMFADWVEFSPYEIGMAKYG
TFMAPDLFGSKFFMGTVVKKYEENPLHFLMGVWGSAFSILFNRVLGVSGSQSRGSTMEEE
LENITTKHIVSNDSSDSDDESHEPKGTENEDAGSDYQSDNQASWIHRMIMALVSDSALFN
TREGRAGKVHNFMLGLNLNTSYPLSPLSDFATQDSFDDDELDAAVADPDEFERIYEPLDV
KSKKIHVVDSGLTFNLPYPLILRPQRGVDLIISFDFSARPSDSSPPFKELLLAEKWAKMN
KLPFPKIDPYVFDREGLKECYVFKPKNPDMEKDCPTIIHFVLANINFRKYRAPGVPRETE
EEKEIADFDIFDDPESPFSTFNFQYPNQAFKRLHDLMHFNTLNNIDVIKEAMVESIEYRR
QNPSRCSVSLSNVEARRFFNKEFLSKPKA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50185357
NameBDBM50185357
Synonyms:1-(3-(4-octylphenoxy)-2-oxopropyl)-1H-indole-5-carbaldehyde | 1-[3-(4-octylphenoxy)-2-oxopropyl]indole-5-carbaldehyde | CHEMBL409321
TypeSmall organic molecule
Emp. Form.C26H31NO3
Mol. Mass.405.5292
SMILESCCCCCCCCc1ccc(OCC(=O)Cn2ccc3cc(C=O)ccc23)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a