Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMatrix metalloproteinase-2 (MMP-2)
LigandBDBM50133496
Substrate/Competitorn/a
Meas. Tech.ChEMBL_622215
IC50 27200±n/a nM
Citation Murata, TSasaki, KSato, KYoshizaki, FYamada, HMutoh, HUmehara, KMiyase, TWarashina, TAoshima, HTabata, HMatsubara, K Matrix metalloproteinase-2 inhibitors from Clinopodium chinense var. parviflorum. J Nat Prod72:1379-84 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Matrix metalloproteinase-2 (MMP-2)
Name:Matrix metalloproteinase-2 (MMP-2)
Synonyms:72 kDa type IV collagenase
Type:n/a
Mol. Mass.:74137.51
Organism:Rattus norvegicus (Rat)
Description:P33436
Residue:662
Sequence:
MEARLVWGVLVGPLRVLCVLCCLLGHAIAAPSPIIKFPGDVSPKTDKELAVQYLNTFYGC
PKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWD
KNQITYRIIGYTPDLDPETVDDAFARALKVWSDVTPLRFSRIHDGEADIMINFGRWEHGD
GYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFN
GREYSSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNGDGQPCKFPFRFQGT
SYNSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKY
ESCTSAGRSDGKVWCATTTNYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGAL
MAPIYTYTKNFRLSNDDIKGIQELYGPSPDADTDTGTGPTPTLGPVTPEICKQDIVFDGI
AQIRGEIFFFKDRFIWRTVTPRDKPTGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGN
EYWVYSASTLERGYPKPLTSLGLPPDVQQVDAAFNWSKNKKTYIFSGDKFWRYNEVKKKM
DPGFPKLIADSWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWL
GC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50133496
n/a
NameBDBM50133496
Synonyms:(2R)-3-(3,4-dihydroxyphenyl)-2-[(2E)-3-(3,4-dihydroxyphenyl)prop-2-enoyloxy]propanoic acid | (R)-rosmarinic acid | CHEMBL324842 | Rosmarinic acid, 2 | cid_5281792
TypeSmall organic molecule
Emp. Form.C18H16O8
Mol. Mass.360.3148
SMILESOC(=O)[C@@H](Cc1ccc(O)c(O)c1)OC(=O)\C=C\c1ccc(O)c(O)c1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: