Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEukaryotic elongation factor 2 kinase
LigandBDBM50314406
Substrate/Competitorn/a
Meas. Tech.ChEMBL_624587
IC50 220±n/a nM
Citation Lockman, JWReeder, MDSuzuki, KOstanin, KHoff, RBhoite, LAustin, HBaichwal, VAdam Willardsen, J Inhibition of eEF2-K by thieno[2,3-b]pyridine analogues. Bioorg Med Chem Lett20:2283-6 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Eukaryotic elongation factor 2 kinase
Name:Eukaryotic elongation factor 2 kinase
Synonyms:Calcium/calmodulin-dependent eukaryotic elongation factor 2 kinase | EEF2K | Eukaryotic elongation factor 2 kinase (EEF2K) | Eukaryotic elongation factor 2 kinase (eEF-2K) | eEF-2 kinase | eEF-2K
Type:Protein
Mol. Mass.:82116.99
Organism:Homo sapiens (Human)
Description:n/a
Residue:725
Sequence:
MADEDLIFRLEGVDGGQSPRAGHDGDSDGDSDDEEGYFICPITDDPSSNQNVNSKVNKYY
SNLTKSERYSSSGSPANSFHFKEAWKHAIQKAKHMPDPWAEFHLEDIATERATRHRYNAV
TGEWLDDEVLIKMASQPFGRGAMRECFRTKKLSNFLHAQQWKGASNYVAKRYIEPVDRDV
YFEDVRLQMEAKLWGEEYNRHKPPKQVDIMQMCIIELKDRPGKPLFHLEHYIEGKYIKYN
SNSGFVRDDNIRLTPQAFSHFTFERSGHQLIVVDIQGVGDLYTDPQIHTETGTDFGDGNL
GVRGMALFFYSHACNRICESMGLAPFDLSPRERDAVNQNTKLLQSAKTILRGTEEKCGSP
QVRTLSGSRPPLLRPLSENSGDENMSDVTFDSLPSSPSSATPHSQKLDHLHWPVFSDLDN
MASRDHDHLDNHRESENSGDSGYPSEKRGELDDPEPREHGHSYSNRKYESDEDSLGSSGR
VCVEKWNLLNSSRLHLPRASAVALEVQRLNALDLEKKIGKSILGKVHLAMVRYHEGGRFC
EKGEEWDQESAVFHLEHAANLGELEAIVGLGLMYSQLPHHILADVSLKETEENKTKGFDY
LLKAAEAGDRQSMILVARAFDSGQNLSPDRCQDWLEALHWYNTALEMTDCDEGGEYDGMQ
DEPRYMMLAREAEMLFTGGYGLEKDPQRSGDLYTQAAEAAMEAMKGRLANQYYQKAEEAW
AQMEE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50314406
NameBDBM50314406
Synonyms:8-(morpholin-4-yl)-11-thia-9,14,16-triazatetracyclo[8.7.0.0^{2,7}.0^{12,17}]heptadeca-1,7,9,12(17),13,15-hexaen-13-amine | CHEMBL1091317
TypeSmall organic molecule
Emp. Form.C17H19N5OS
Mol. Mass.341.431
SMILESNc1ncnc2c1sc1nc(N3CCOCC3)c3CCCCc3c21
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a