Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDeath-associated protein kinase 3
LigandBDBM50314663
Substrate/Competitorn/a
Meas. Tech.ChEMBL_625624
IC50 583±n/a nM
Citation Okamoto, MTakayama, KShimizu, TMuroya, AFuruya, T Structure-activity relationship of novel DAPK inhibitors identified by structure-based virtual screening. Bioorg Med Chem18:2728-34 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Death-associated protein kinase 3
Name:Death-associated protein kinase 3
Synonyms:DAP kinase 3 | DAP-like kinase | DAPK3 | ZIP-kinase
Type:PROTEIN
Mol. Mass.:52537.07
Organism:Homo sapiens (Human)
Description:ChEMBL_586564
Residue:454
Sequence:
MSTFRQEDVEDHYEMGEELGSGQFAIVRKCRQKGTGKEYAAKFIKKRRLSSSRRGVSREE
IEREVNILREIRHPNIITLHDIFENKTDVVLILELVSGGELFDFLAEKESLTEDEATQFL
KQILDGVHYLHSKRIAHFDLKPENIMLLDKNVPNPRIKLIDFGIAHKIEAGNEFKNIFGT
PEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGETKQETLTNISAVNYDFDEEY
FSNTSELAKDFIRRLLVKDPKRRMTIAQSLEHSWIKAIRRRNVRGEDSGRKPERRRLKTT
RLKEYTIKSHSSLPPNNSYADFERFSKVLEEAAAAEEGLRELQRSRRLCHEDVEALAAIY
EEKEAWYREESDSLGQDLRRLRQELLKTEALKRQAQEEAKGALLGTSGLKRRFSRLENRY
EALAKQVASEMRFVQDLVRALEQEKLQGVECGLR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50314663
NameBDBM50314663
Synonyms:2-phenyl-4-(pyridin-3-ylmethylene)oxazol-5(4H)-one | 2-phenyl-4-(pyridin-3-ylmethylene)oxazol-5(4H)-one(Z)-2-phenyl-4-(pyridin-3-ylmethylene)oxazol-5(4H)-one | CHEMBL579387
TypeSmall organic molecule
Emp. Form.C15H10N2O2
Mol. Mass.250.2521
SMILESO=C1OC(=N\C1=C/c1cccnc1)c1ccccc1 |c:3|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a