Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A1
LigandBDBM50316886
Substrate/Competitorn/a
Meas. Tech.ChEMBL_629846
Ki 194±n/a nM
Citation Shook, BCRassnick, SChakravarty, DWallace, NAult, MCrooke, JBarbay, JKWang, ALeonard, KPowell, MTAlford, VHall, DRupert, KCHeintzelman, GRHansen, KBullington, JLScannevin, RHCarroll, KLampron, LWestover, LRussell, RBranum, SWells, KDamon, SYouells, SBeauchamp, DLi, XRhodes, KJackson, PF Optimization of arylindenopyrimidines as potent adenosine A(2A)/A(1) antagonists. Bioorg Med Chem Lett20:2868-71 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A1
Name:Adenosine receptor A1/Alpha-2A adrenergic receptor
Synonyms:A1 adenosine receptor (hA1) | A1AR | ADENOSINE A1 | ADORA1 | Adenosine A1 receptor (A1AR) | Adenosine A1-receptor | Adenosine receptor A1 (A1) | Adenosine receptor A1 (hA1) | Adenosine transporter (AdT)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:36520.92
Organism:Homo sapiens (Human)
Description:P30542
Residue:326
Sequence:
MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVT
PRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFL
KIWNDHFRCQPAPPIDEDLPEERPDD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50316886
NameBDBM50316886
Synonyms:2-amino-4-phenyl-8-(2-(piperidin-1-yl)ethoxy)-5H-indeno[1,2-d]pyrimidin-5-one | CHEMBL1095487
TypeSmall organic molecule
Emp. Form.C24H24N4O2
Mol. Mass.400.473
SMILESNc1nc2-c3cc(OCCN4CCCCC4)ccc3C(=O)c2c(n1)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a