Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A2a
LigandBDBM50316888
Substrate/Competitorn/a
Meas. Tech.ChEMBL_629845
Ki 18.1±n/a nM
Citation Shook, BCRassnick, SChakravarty, DWallace, NAult, MCrooke, JBarbay, JKWang, ALeonard, KPowell, MTAlford, VHall, DRupert, KCHeintzelman, GRHansen, KBullington, JLScannevin, RHCarroll, KLampron, LWestover, LRussell, RBranum, SWells, KDamon, SYouells, SBeauchamp, DLi, XRhodes, KJackson, PF Optimization of arylindenopyrimidines as potent adenosine A(2A)/A(1) antagonists. Bioorg Med Chem Lett20:2868-71 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A2a
Name:Adenosine receptor A2a
Synonyms:A2A adenosine receptor (hA2A) | ADENOSINE A2 | ADENOSINE A2a | ADORA2 | ADORA2A | Adenosine A2A receptor (A2AAR)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:44716.46
Organism:Homo sapiens (Human)
Description:P29274
Residue:412
Sequence:
MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAI
PFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTR
AKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYF
NFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVG
LFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFR
KIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNG
YALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50316888
NameBDBM50316888
Synonyms:2-amino-4-(4-fluorophenyl)-8-(2-morpholinoethoxy)-5H-indeno[1,2-d]pyrimidin-5-one | CHEMBL1095489
TypeSmall organic molecule
Emp. Form.C23H21FN4O3
Mol. Mass.420.4362
SMILESNc1nc2-c3cc(OCCN4CCOCC4)ccc3C(=O)c2c(n1)-c1ccc(F)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a