Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A2
LigandBDBM50317020
Substrate/Competitorn/a
Meas. Tech.ChEMBL_630130
Ki 7.9±n/a nM
Citation Shook, BCRassnick, SHall, DRupert, KCHeintzelman, GRHansen, KChakravarty, DBullington, JLScannevin, RHMagliaro, BWestover, LCarroll, KLampron, LRussell, RBranum, SWells, KDamon, SYouells, SLi, XOsbourne, MDemarest, KTang, YRhodes, KJackson, PF Methylene amine substituted arylindenopyrimidines as potent adenosine A(2A)/A(1) antagonists. Bioorg Med Chem Lett20:2864-7 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A2
Name:Adenosine receptors; A1 & A2a
Synonyms:A2A adenosine receptor (hA2A) | ADENOSINE A2 | ADENOSINE A2a | ADORA2 | ADORA2A | Adenosine A2A receptor (A2AAR)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:44716.46
Organism:Homo sapiens (Human)
Description:P29274
Residue:412
Sequence:
MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAI
PFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTR
AKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYF
NFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVG
LFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFR
KIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNG
YALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50317020
NameBDBM50317020
Synonyms:9-((4-acetylpiperazin-1-yl)methyl)-2-amino-4-phenyl-5H-indeno[1,2-d]pyrimidin-5-one | CHEMBL1087819
TypeSmall organic molecule
Emp. Form.C24H23N5O2
Mol. Mass.413.4717
SMILESCC(=O)N1CCN(Cc2cccc3C(=O)c4c(nc(N)nc4-c4ccccc4)-c23)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a