Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCathepsin E
LigandBDBM50317048
Substrate/Competitorn/a
Meas. Tech.ChEMBL_630327
Ki 86±n/a nM
Citation Cumming, JBabu, SHuang, YCarrol, CChen, XFavreau, LGreenlee, WGuo, TKennedy, MKuvelkar, RLe, TLi, GMcHugh, NOrth, POzgur, LParker, ESaionz, KStamford, AStrickland, CTadesse, DVoigt, JZhang, LZhang, Q Piperazine sulfonamide BACE1 inhibitors: design, synthesis, and in vivo characterization. Bioorg Med Chem Lett20:2837-42 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cathepsin E
Name:Cathepsin E
Synonyms:n/a
Type:Enzyme
Mol. Mass.:43298.99
Organism:Homo sapiens (Human)
Description:P14091
Residue:401
Sequence:
MKTLLLLLLVLLELGEAQGSLHRVPLRRHPSLKKKLRARSQLSEFWKSHNLDMIQFTESC
SMDQSAKEPLINYLDMEYFGTISIGSPPQNFTVIFDTGSSNLWVPSVYCTSPACKTHSRF
QPSQSSTYSQPGQSFSIQYGTGSLSGIIGADQVSAFATQVEGLTVVGQQFGESVTEPGQT
FVDAEFDGILGLGYPSLAVGGVTPVFDNMMAQNLVDLPMFSVYMSSNPEGGAGSELIFGG
YDHSHFSGSLNWVPVTKQAYWQIALDNIQVGGTVMFCSEGCQAIVDTGTSLITGPSDKIK
QLQNAIGAAPVDGEYAVECANLNVMPDVTFTINGVPYTLSPTAYTLLDFVDGMQFCSSGF
QGLDIHPPAGPLWILGDVFIRQFYSVFDRGNNRVGLAPAVP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50317048
NameBDBM50317048
Synonyms:CHEMBL1097342 | N-((1S,2S)-3-(3,5-difluorophenyl)-1-hydroxy-1-((R)-4-(m-tolylsulfonyl)piperazin-2-yl)propan-2-yl)-3-((R)-2-(methoxymethyl)pyrrolidine-1-carbonyl)-5-methylbenzamide | N-[(1S,2S)-1-(3,5-difluorobenzyl)-2-hydroxy-2-{(2R)-4-[(3-methylphenyl)sulfonyl]piperazin-2-yl}ethyl]-3-{[(2R)-2-(methoxymethyl)pyrrolidin-1-yl]carbonyl}-5-methylbenzamide
TypeSmall organic molecule
Emp. Form.C35H42F2N4O6S
Mol. Mass.684.793
SMILESCOC[C@H]1CCCN1C(=O)c1cc(C)cc(c1)C(=O)N[C@@H](Cc1cc(F)cc(F)c1)[C@H](O)[C@H]1CN(CCN1)S(=O)(=O)c1cccc(C)c1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a