Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target11-beta-hydroxysteroid dehydrogenase 1
LigandBDBM50317226
Substrate/Competitorn/a
Meas. Tech.ChEMBL_631347
IC50 0.03±n/a nM
Citation Cheng, HHoffman, JLe, PNair, SKCripps, SMatthews, JSmith, CYang, MKupchinsky, SDress, KEdwards, MCole, BWalters, ELoh, CErmolieff, JFanjul, ABhat, GBHerrera, JPauly, THosea, NPaderes, GRejto, P The development and SAR of pyrrolidine carboxamide 11beta-HSD1 inhibitors. Bioorg Med Chem Lett20:2897-902 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
11-beta-hydroxysteroid dehydrogenase 1
Name:11-beta-hydroxysteroid dehydrogenase 1
Synonyms:11-DH | 11-beta-HSD1 | 11-beta-Hydroxysteroid Dehydrogenase 1 (11-beta-HSD1) | 11-beta-hydroxysteroid dehydrogenase 1 (11HSD1) | Corticosteroid 11-beta-dehydrogenase isozyme 1 | Corticosteroid 11-beta-dehydrogenase isozyme 1 (11-beta-HSD-1) | Corticosteroid 11-beta-dehydrogenase isozyme 1 (11-beta-HSD1) | Corticosteroid 11-beta-dehydrogenase isozyme 1 (11beta-HSD1)
Type:Enzyme
Mol. Mass.:32409.16
Organism:Homo sapiens (Human)
Description:P28845
Residue:292
Sequence:
MAFMKKYLLPILGLFMAYYYYSANEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAH
VVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNH
ITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMV
AAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEE
CALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50317226
NameBDBM50317226
Synonyms:(2R)-N-(adamantan-2-yl)-1-[(1-hydroxycyclohexyl)methyl]pyrrolidine-2-carboxamide | CHEMBL1096451
TypeSmall organic molecule
Emp. Form.C22H36N2O2
Mol. Mass.360.5334
SMILESOC1(CN2CCC[C@@H]2C(=O)NC2C3CC4CC(C3)CC2C4)CCCCC1 |r,wU:7.8,TLB:17:16:20:13.12.11,17:12:15.16.18:20,THB:11:12:15:18.19.20,11:19:15:13.17.12,10:11:15.16.18:20,(-3.5,-9.88,;-3.33,-8.35,;-4.87,-8.34,;-5.77,-9.59,;-7.3,-9.61,;-7.77,-11.07,;-6.53,-11.97,;-5.31,-10.99,;-3.8,-11.51,;-2.45,-10.75,;-3.83,-13.05,;-5.18,-13.79,;-5.19,-15.33,;-6.59,-15.69,;-7.93,-15.19,;-9.13,-16.47,;-7.62,-16.05,;-6.2,-16.61,;-7.63,-14.46,;-6.58,-13.21,;-7.94,-13.7,;-2.01,-9.12,;-.66,-8.36,;-.66,-6.82,;-1.99,-6.04,;-3.32,-6.81,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a