Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLeukotriene 2
LigandBDBM50317624
Substrate/Competitorn/a
Meas. Tech.ChEMBL_632892
IC50 3060±n/a nM
Citation Goodnow, RAHicks, ASidduri, AKowalczyk, ADominique, RQiao, QLou, JPGillespie, PFotouhi, NTilley, JCohen, NChoudhry, SCavallo, GTannu, SAVentre, JDLavelle, DTare, NSOh, HLamb, MKurylko, GHamid, RWright, MBPamidimukkala, AEgan, TGubler, UHoffman, AFWei, XLi, YLO'Neil, JMarcano, RPozzani, KMolinaro, TSantiago, JSinger, LHargaden, MMoore, DCatala, ARChao, LCHermann, GVenkat, RMancebo, HRenzetti, LM Discovery of novel and potent leukotriene B4 receptor antagonists. Part 1. J Med Chem53:3502-16 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Leukotriene 2
Name:Leukotriene B4 receptor
Synonyms:LTB4 receptor JULF2 | LTB4-R2 | LTB4R2 | LTB4R2 protein | Leukotriene B4 | Leukotriene B4 R2 | Leukotriene B4 receptor 2 | Leukotriene B4 receptor BLT2 | Leukotriene b1 | Seven transmembrane receptor BLTR2
Type:Enzyme Catalytic Domain
Mol. Mass.:41553.59
Organism:Homo sapiens (Human)
Description:Leukotriene 2 0 HUMAN::Q9NPC1
Residue:389
Sequence:
MAPSHRASQVGFCPTPERPLWRLPPTCRPRRMSVCYRPPGNETLLSWKTSRATGTAFLLL
AALLGLPGNGFVVWSLAGWRPARGRPLAATLVLHLALADGAVLLLTPLFVAFLTRQAWPL
GQAGCKAVYYVCALSMYASVLLTGLLSLQRCLAVTRPFLAPRLRSPALARRLLLAVWLAA
LLLAVPAAVYRHLWRDRVCQLCHPSPVHAAAHLSLETLTAFVLPFGLMLGCYSVTLARLR
GARWGSGRHGARVGRLVSAIVLAFGLLWAPYHAVNLLQAVAALAPPEGALAKLGGAGQAA
RAGTTALAFFSSSVNPVLYVFTAGDLLPRAGPRFLTRLFEGSGEARGGGRSREGTMELRT
TPQLKVVGQGRGNGDPGGGMEKDGPEWDL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50317624
NameBDBM50317624
Synonyms:4-(2-(2-carboxyethyl)-3-(6-(4,6-diphenylpyridin-2-yloxy)hexyl)phenoxy)butanoic acid | CHEMBL1099330
TypeSmall organic molecule
Emp. Form.C36H39NO6
Mol. Mass.581.698
SMILESOC(=O)CCCOc1cccc(CCCCCCOc2cc(cc(n2)-c2ccccc2)-c2ccccc2)c1CCC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a