Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLTB4R
LigandBDBM50317638
Substrate/Competitorn/a
Meas. Tech.ChEMBL_632889
IC50 0.58±n/a nM
Citation Goodnow, RAHicks, ASidduri, AKowalczyk, ADominique, RQiao, QLou, JPGillespie, PFotouhi, NTilley, JCohen, NChoudhry, SCavallo, GTannu, SAVentre, JDLavelle, DTare, NSOh, HLamb, MKurylko, GHamid, RWright, MBPamidimukkala, AEgan, TGubler, UHoffman, AFWei, XLi, YLO'Neil, JMarcano, RPozzani, KMolinaro, TSantiago, JSinger, LHargaden, MMoore, DCatala, ARChao, LCHermann, GVenkat, RMancebo, HRenzetti, LM Discovery of novel and potent leukotriene B4 receptor antagonists. Part 1. J Med Chem53:3502-16 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
LTB4R
Name:Leukotriene B4 receptor
Synonyms:Chemoattractant receptor-like 1 | G-protein coupled receptor 16 | LTB4-R 1 | Leukotriene B4 R1 | Leukotriene B4 receptor | Leukotriene B4 receptor 1 | P2Y purinoceptor 7 | P2Y7
Type:Enzyme Catalytic Domain
Mol. Mass.:37582.68
Organism:Homo sapiens (Human)
Description:Leukotriene B4 R1 LTB4R HUMAN::Q15722
Residue:352
Sequence:
MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNL
ALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVA
RPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAF
HLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVV
NLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGF
VAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50317638
NameBDBM50317638
Synonyms:4-{2-(2-Carboxy-ethyl)-3-[6-(3,5-di-thiophen-3-yl-phenoxy)-hexyl]-phenoxy}-butyric acid | CHEMBL1098550
TypeSmall organic molecule
Emp. Form.C33H36O6S2
Mol. Mass.592.765
SMILESOC(=O)CCCOc1cccc(CCCCCCOc2cc(cc(c2)-c2ccsc2)-c2ccsc2)c1CCC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a