Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein kinase CSK
LigandBDBM12255
Substrate/Competitorn/a
Meas. Tech.ChEMBL_633635
IC50 840±n/a nM
Citation Allen, JGFotsch, CBabij, P Emerging targets in osteoporosis disease modification. J Med Chem53:4332-53 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein kinase CSK
Name:Tyrosine-protein kinase CSK
Synonyms:C-SRC kinase | C-src tyrosine kinase | CSK | Protein-tyrosine kinase CYL | Tyrosine Kinase CSK
Type:Tyrosine-protein kinase
Mol. Mass.:50707.30
Organism:Homo sapiens (Human)
Description:n/a
Residue:450
Sequence:
MSAIQAAWPSGTECIAKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGII
PANYVQKREGVKAGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCV
SCDGKVEHYRIMYHASKLSIDEEVYFENLMQLVEHYTSDADGLCTRLIKPKVMEGTVAAQ
DEFYRSGWALNMKELKLLQTIGKGEFGDVMLGDYRGNKVAVKCIKNDATAQAFLAEASVM
TQLRHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVCE
AMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTKEASSTQDTGKLPVKWTAPEALRE
KKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMK
NCWHLDAAMRPSFLQLREQLEHIKTHELHL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM12255
NameBDBM12255
Synonyms:AZD0530 | CHEMBL217092 | Compound 33 | N-(5-chloro-2H-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5-(oxan-4-yloxy)quinazolin-4-amine | Saracatinib
TypeSmall organic molecule
Emp. Form.C27H32ClN5O5
Mol. Mass.542.026
SMILESCN1CCN(CCOc2cc(OC3CCOCC3)c3c(Nc4c5OCOc5ccc4Cl)ncnc3c2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a